Identifiers and Description

Gene Model Identifier

SteCoe_8836

Standard Name

None

Aliases

None

Description

Nucleoside_tran domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18964.0.g301.2995814250075031e-24Nucleoside transporter

Tetrahymena ThermophilaTTHERM_010469100.0000000000006914400106940203Nucleoside transporter family
protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_8836(Protein)
MSGNEKLLLSEITLQGIGVLISWNSILTALDWYNNRFPNLDPGFWIPFLNYLPSLIFQPL
TIIYGHKFTFNIRINVANIIIAIILVMTPIIVELTTKTTGFICICILTVLMGSANAVGQT
SLFGLTGALPKKYTNAAMLGNGLSGLSITIIRLICLSIFPSNSSGYLHSTEVYFIISGCT
LIICCVVQLHLMKHPLIIECLSKTHSKEASKIAKITVEDELESFSDSTGYHHIHKEKISY
KNLFSKIWQYLFLVWLNFVITFGMLSHVALATDASEMSYPVFSTLMIFVFNFCDVLGRYT
PTLHLLKKSMLWVFTISRFVFWVTFILIASDDPSVSPAWLFSWTWFKFVNMALYSYTNGY
SCTCSMIHGPSVVSDVYKDKAGYIMVSGLILGIFSGQIISYAFQNIGKVPS


>SteCoe_8836(CDS)
ATGTCAGGAAACGAAAAGCTCCTCCTAAGCGAAATAACACTTCAAGGTATTGGTGTTCTT
ATAAGCTGGAATTCTATTCTCACAGCACTAGACTGGTACAACAATCGTTTCCCAAATCTT
GACCCAGGTTTTTGGATTCCATTCCTCAACTACCTTCCATCACTAATCTTCCAACCTTTG
ACAATAATATATGGTCACAAGTTTACATTCAATATCCGTATCAATGTAGCAAATATCATA
ATAGCAATAATTCTTGTAATGACTCCTATTATTGTTGAATTAACTACAAAAACAACTGGT
TTTATATGTATTTGTATACTAACTGTTCTTATGGGAAGCGCTAATGCTGTTGGGCAAACA
AGTCTTTTTGGACTAACTGGCGCATTACCTAAAAAATACACTAACGCAGCTATGCTTGGA
AATGGTTTATCAGGCCTTTCTATAACAATTATAAGATTGATTTGCCTTAGTATTTTCCCA
AGCAACTCATCTGGATATTTGCATAGCACTGAAGTATATTTTATTATATCAGGATGTACT
CTTATTATTTGTTGTGTTGTACAATTACATTTGATGAAACATCCTTTGATTATTGAATGT
TTAAGTAAAACACATTCAAAAGAAGCATCGAAAATAGCGAAAATTACTGTAGAAGATGAA
TTAGAATCTTTTAGTGATTCAACTGGATATCATCATATACATAAAGAGAAAATCAGTTAT
AAGAATTTGTTTTCGAAAATTTGGCAGTATTTGTTTTTGGTTTGGTTAAATTTTGTCATC
ACTTTCGGTATGTTAAGTCATGTAGCTTTAGCAACAGATGCGAGTGAAATGTCGTATCCA
GTTTTTAGTACTTTGATGATTTTTGTTTTTAATTTTTGTGATGTACTTGGAAGATATACA
CCAACATTACATTTACTTAAGAAATCTATGTTGTGGGTGTTTACAATTAGTAGATTTGTG
TTTTGGGTTACTTTTATACTTATTGCTTCTGATGATCCTTCAGTATCACCAGCTTGGCTA
TTTTCATGGACATGGTTTAAGTTTGTTAATATGGCTCTTTATTCTTATACAAATGGATAT
TCTTGTACTTGCTCTATGATTCATGGGCCTTCGGTTGTTTCTGATGTTTATAAAGATAAA
GCTGGATATATAATGGTCAGTGGTTTAATTTTGGGAATTTTTTCTGGACAAATTATATCT
TATGCCTTTCAAAATATCGGCAAAGTACCTAGTTAA