Identifiers and Description

Gene Model Identifier

SteCoe_894

Standard Name

None

Aliases

None

Description

Citrate_synt domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer (IEA) | GO:0046912

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYNR001C9.462629465836378e-57Citrate synthase; catalyzes th
e condensation of acetyl coenz
yme A and oxaloacetate to form
citrate; the rate-limiting en
zyme of the TCA cycle; nuclear
encoded mitochondrial protein
; CIT1 has a paralog, CIT2, th
at arose from the whole genome
duplication
WormBaseWBGene000008331.4043787324419038e-54
Oxytricha TrifallaxContig5416.0.g813.817497188671175e-54Citrate synthase

Tetrahymena ThermophilaTTHERM_005297907.667648073722e-53Citrate synthase; bifunctional
14-nm filament-forming protei
n; structural protein involved
in oral morphogenesis and pro
nuclear behavior during conjug
ation; citrate synthase activi
ty decreased by polymerization
and dephosphorylation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_894(Protein)
MHFKIVRKIAELHGILENKIAARLEQVHRLKYKYGSVKIEEIKVEQIVKGMKGMATQLTE
SLSLDPDFGIRFRGFSIEECQEKLPKKRTQPYIESMIWLLLTGEIPTPTQVDILKRELAL
RCFLPKYTEDMLKKITDHFHPMNQLSMGVLSLGYHSNFDKLYNSHMKKREYWKPMLDDSL
DLIAKIPRIASIIYRNSYRNGVTHDSDPSADFAENFGKMLGWDDEDFHEFLRLYINTHCD
HEAGNVIAHTSHVVGSALCNVFNAYSAGLNGLAGPIHGLSSQECLRWLINLWKKVGDYPT
DKAIAEYAKNCLDSGKGIPGYGHEMLRIPDPRFIAQLKFASEMLPNDPLCNLVGQCFRVI
PDVLKEFGKTKYPFPNAEAHSEVLMYSYGLRIYDYYPVLFGVARAIGCCINLVWDRALMF
PLERPDGITIDSMMKISLEK


>SteCoe_894(CDS)
ATGCACTTTAAAATTGTTCGAAAAATCGCTGAACTTCATGGAATATTGGAAAACAAAATC
GCAGCAAGGCTTGAACAAGTGCATCGGCTTAAGTATAAATACGGATCGGTAAAGATAGAA
GAGATAAAAGTTGAGCAAATCGTAAAAGGTATGAAAGGGATGGCGACTCAACTAACAGAA
TCTCTATCTCTAGATCCCGATTTTGGTATCCGTTTTCGAGGGTTTTCAATAGAAGAGTGC
CAAGAAAAGTTGCCAAAAAAGCGTACCCAGCCTTACATAGAATCTATGATCTGGTTGCTT
TTAACAGGTGAGATCCCAACCCCAACTCAAGTTGATATCTTAAAAAGAGAATTAGCTTTA
AGATGTTTCTTACCAAAATACACTGAAGACATGTTAAAAAAAATAACAGATCATTTCCAC
CCAATGAATCAATTATCCATGGGTGTATTATCCTTAGGTTATCATAGTAATTTTGATAAA
CTTTACAACTCACACATGAAAAAACGTGAATACTGGAAACCTATGCTCGATGATAGTTTA
GACCTCATAGCAAAAATCCCTAGAATTGCATCAATAATATATAGAAACTCATATAGAAAT
GGAGTCACACATGATTCTGACCCATCAGCAGATTTCGCTGAGAACTTTGGTAAAATGCTT
GGTTGGGATGATGAAGATTTTCATGAATTCCTCCGTCTTTATATAAACACTCATTGTGAT
CATGAAGCTGGTAATGTTATAGCTCATACATCTCATGTTGTAGGAAGTGCTTTATGTAAT
GTTTTTAATGCATATTCAGCTGGGTTAAATGGACTTGCAGGGCCAATACATGGTTTATCA
AGCCAAGAGTGTTTAAGATGGCTTATAAATTTATGGAAAAAAGTAGGGGATTATCCAACA
GATAAAGCTATAGCTGAATATGCTAAAAACTGTTTAGATTCAGGTAAAGGTATTCCTGGA
TATGGACATGAAATGTTAAGAATCCCAGATCCAAGGTTTATTGCTCAGTTGAAATTTGCT
AGTGAAATGCTCCCAAATGATCCTTTATGTAACCTTGTAGGACAATGTTTTAGAGTTATA
CCTGATGTTTTGAAAGAGTTTGGGAAAACTAAATATCCTTTTCCTAATGCAGAAGCACAT
AGTGAGGTTTTGATGTATTCATATGGTTTAAGAATTTATGATTATTATCCGGTATTGTTT
GGAGTTGCTAGAGCTATTGGATGTTGTATAAATTTAGTCTGGGATCGAGCATTGATGTTT
CCATTAGAAAGACCTGATGGGATAACTATTGATAGTATGATGAAGATATCTTTAGAGAAA
TAG