Identifiers and Description

Gene Model Identifier

SteCoe_9020

Standard Name

None

Aliases

None

Description

EF-hand_7 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig1124.1.g1111.5007857627073948e-41EF hand

Tetrahymena ThermophilaTTHERM_006898503.6251409191435593e-34Centrin family member; EF-hand
calcium-binding protein; also
called caltractin; GFP-fusion
protein localized to speciali
zed structures in the oral app
aratus and along deep rootlet
WormBaseWBGene000005527.781132241133797e-20
Saccharomyces CerevisiaeYOR257W4.248354255291589e-18Calcium-binding component of t
he spindle pole body (SPB) hal
f-bridge; required for SPB dup
lication in mitosis and meiosi
s II; homolog of mammalian cen
trin; binds multiubiquitinated
proteins and is involved in p
roteasomal protein degradation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9020(Protein)
MAGRGQPAKPAPVSQPKVFNPKQYERPGLTEDEIEEIKEAFDLFDSDGSGTIDPAELKSA
MQSLGFEAKNQTIYQMISDLDKDGSGAIDFDEFLDMMTARMSDKDTKEDINKVFRLFDDD
KTGYITIKNLRRVAKELGETMTDEELMEMIERADSDGDGQVSTEDFYNIMTKKAFP


>SteCoe_9020(CDS)
ATGGCAGGAAGAGGACAACCAGCTAAACCAGCCCCAGTTAGTCAACCAAAGGTATTCAAC
CCTAAACAATACGAAAGACCAGGGCTTACTGAAGATGAAATCGAAGAAATCAAGGAAGCT
TTTGACCTCTTTGACTCAGACGGATCAGGAACCATTGACCCAGCTGAATTGAAGTCAGCT
ATGCAAAGTTTGGGATTTGAAGCTAAAAACCAAACTATTTACCAAATGATTAGTGATTTG
GATAAGGATGGCTCAGGAGCTATTGACTTTGATGAATTCTTGGATATGATGACTGCAAGA
ATGAGCGATAAAGATACAAAAGAAGATATTAACAAAGTCTTCAGATTGTTTGATGATGAT
AAGACTGGATATATCACCATTAAGAACTTGAGAAGAGTCGCTAAGGAACTTGGAGAAACC
ATGACTGATGAAGAACTCATGGAAATGATTGAAAGAGCTGACTCAGATGGTGATGGGCAA
GTTAGCACGGAAGATTTCTATAATATCATGACCAAGAAAGCTTTCCCTTAA