Identifiers and Description

Gene Model Identifier

SteCoe_9056

Standard Name

None

Aliases

None

Description

Helicase_C_3 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig12817.0.g890Type III restriction enzyme, r
es subunit

WormBaseWBGene000134410
Tetrahymena ThermophilaTTHERM_005296201.6889118802245324e-48DNA repair helicase rad25 fami
ly protein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9056(Protein)
MEDRLPAKRRIRSPPESISKYFDFDFSNFKLKENHQELPLWICSNGHIFLETSAPSYLQI
TDFLIAIAEPISRPEHIHEYILTRYSLYAAVSVKLETEDIVSTLQRYSKTLEIPSSVIDF
ININTAQYGKAKLVLKQNRYFIESPYENVISDLLNIESVRKGKEAASDVNMEIQESHVED
VKEEMIRIMDGENPEDIEKVESCCVANEYIPQIRQDCHKENFPLIEEYDFIKDDKSPRLE
IDLKPSTHIRSYQEKSLSKMFSNGRARSGVIVLPCGSGKTLVGITAICTVKKRAVILCTS
GVAVDQWKRQLEMWSTIDPALIACFTSQNKDCTIDVAKACVVISTYSMMGYGGKRSAESA
SVYEKISRVDWGLLVMDEVQVVPADMFRRVIFDVKSHCKLGLTATLVREDNRIEDLNFLI
GPKLYEANWLDMQAQGFIAKVQCIEVWCPMTAEFFQEYLNAKPRKKLLLYVANPNKLMTC
QYLVKKHEAMGDKIIIFSDNLYIMELYSQHLKLPMIKGNVGHSERSRILFNFENTNACNT
ILISKVGDNSIDLPGANVIIQISSHFGSRRQEAQRLGRILRPKINSMDNDFNAYFYSLVS
QDTQEMWYADKRQQFLIDQGYAYKVVSLTEEIQRQNDLMFYKKEDQKTLLEKLLQARDMD
DDIQVDPDDITPEAMSKKSADAFSSNTSTTTSRSYQIQAHSRNRLFADRYKKFKKNK


>SteCoe_9056(CDS)
ATGGAGGACCGTCTGCCTGCAAAAAGAAGGATCCGATCGCCTCCCGAAAGTATTTCAAAA
TACTTTGACTTCGATTTCTCCAACTTCAAACTTAAAGAAAACCATCAAGAACTTCCTCTT
TGGATCTGCAGCAACGGGCATATTTTCTTAGAAACCTCAGCCCCTTCATATTTACAAATC
ACTGATTTCCTTATAGCAATAGCTGAACCAATTTCCCGTCCAGAGCATATTCATGAATAC
ATTCTCACAAGATATTCTTTATATGCAGCAGTCTCAGTAAAATTAGAAACTGAAGATATA
GTCTCAACACTTCAAAGATACTCAAAAACATTAGAAATCCCAAGTTCAGTAATTGATTTT
ATTAATATAAACACTGCTCAATATGGAAAAGCTAAACTCGTTCTTAAACAAAATCGATAT
TTTATTGAATCACCATATGAAAATGTTATTTCTGATCTGCTTAATATAGAAAGTGTGAGA
AAAGGTAAAGAAGCAGCTAGTGATGTGAATATGGAAATACAAGAAAGTCATGTTGAAGAT
GTTAAAGAGGAAATGATTAGGATTATGGATGGAGAAAACCCTGAAGATATTGAGAAAGTT
GAAAGCTGCTGTGTAGCGAATGAATATATTCCTCAGATCAGACAGGATTGTCATAAAGAA
AATTTCCCTCTTATTGAAGAGTATGATTTTATTAAAGATGATAAGAGTCCAAGGCTGGAG
ATTGATCTTAAACCCAGTACGCATATTAGGTCTTATCAAGAAAAAAGTTTGAGTAAAATG
TTTAGCAACGGCAGGGCGAGATCTGGAGTGATTGTCTTACCATGTGGATCAGGTAAGACT
TTAGTCGGTATCACGGCGATCTGTACAGTCAAAAAACGTGCTGTTATTCTTTGCACAAGT
GGTGTGGCTGTTGATCAATGGAAAAGACAGCTTGAAATGTGGAGTACAATTGACCCAGCA
TTAATAGCTTGTTTTACTTCACAAAACAAAGATTGCACAATAGATGTGGCTAAAGCTTGT
GTAGTAATTTCAACTTATTCTATGATGGGATATGGAGGTAAACGTTCAGCTGAATCCGCA
TCAGTTTATGAAAAAATAAGCCGTGTTGACTGGGGACTTTTAGTTATGGATGAAGTTCAA
GTAGTTCCAGCAGATATGTTTCGTCGTGTGATTTTTGATGTAAAAAGTCATTGTAAACTA
GGTCTTACCGCTACTTTAGTTAGAGAAGATAATCGTATTGAAGACTTGAACTTTTTAATT
GGACCTAAATTATATGAAGCTAATTGGCTTGATATGCAAGCACAAGGATTTATCGCTAAA
GTACAATGTATTGAAGTCTGGTGCCCTATGACAGCTGAGTTCTTTCAAGAATATCTTAAT
GCAAAACCAAGGAAAAAATTATTACTTTATGTGGCAAATCCTAATAAACTCATGACATGT
CAATATCTTGTTAAAAAACATGAAGCTATGGGTGATAAGATTATTATTTTTTCAGACAAT
TTATATATAATGGAACTTTATAGCCAACATTTAAAACTCCCTATGATTAAAGGAAATGTT
GGTCATAGTGAAAGATCAAGGATTTTATTTAATTTTGAAAATACTAATGCTTGCAATACA
ATTTTGATTTCAAAAGTTGGGGATAACTCTATTGATTTACCTGGGGCAAATGTGATTATA
CAGATATCATCACATTTTGGTAGTAGAAGGCAGGAAGCACAAAGACTTGGTAGGATTTTA
CGTCCTAAGATCAATAGTATGGATAATGATTTTAATGCGTATTTTTATTCTTTAGTGTCA
CAAGATACACAAGAAATGTGGTATGCTGATAAAAGACAACAATTTCTTATAGACCAAGGA
TATGCTTATAAAGTTGTAAGTTTAACAGAAGAGATTCAAAGGCAAAATGACCTGATGTTT
TATAAAAAAGAAGACCAGAAAACTTTATTAGAAAAACTTCTTCAAGCTAGAGATATGGAT
GATGATATACAAGTTGATCCTGATGATATAACCCCTGAAGCTATGAGTAAGAAATCAGCT
GATGCTTTTTCATCAAACACTTCAACTACCACAAGCAGAAGTTATCAAATACAAGCACAT
TCTCGAAATAGACTTTTTGCTGATAGGTATAAGAAATTCAAAAAAAATAAGTAA