Identifiers and Description

Gene Model Identifier

SteCoe_9081

Standard Name

None

Aliases

None

Description

PRP3 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005999603.873997628687187e-21U4/U6 small nuclear ribonucleo
protein
Oxytricha TrifallaxContig413.1.g1002.8625185805493937e-20pre-mRNA processing factor 3 (
PRP3)

WormBaseWBGene000108445.74952226429356e-19

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9081(Protein)
MDLPEKRPREEPSKVKMDEKGRLIDEHGREVDLSYSNRIDLDVNKQRFEKKKKKQHKFLQ
NLKESSKSRGFFFDKNLPKKKSSKKISMGFNFTNTNEEIKLIANVTPDIEWWDKEITNSY
SELYNPDAITAEIFNATLPIQLPFNTTTHNVTMHLTEKEKKKIKRLKKAQKLKEIREKIK
LGLMEAPPAKIKISSLMRVMSRELAQDPSKTEHEIMEKYNERLQKHIARNEESKLTHAQR
VEKALRKRRRDSARESRIAVFKISYFSSTKIKFKLMKNASQLALVGICLILPSPSPSIII
VEGGKRAIKFYTRLCLHRIDWKSDNSSCELVWNTEIKDAKFFKFKILSVESELDLKRILS
KKDAMNYWSLVCTWKGNNDMLL


>SteCoe_9081(CDS)
ATGGATTTACCCGAAAAAAGACCTAGAGAAGAGCCCTCCAAGGTTAAAATGGACGAAAAA
GGACGCTTGATCGATGAGCATGGACGAGAAGTTGATCTTTCTTACTCAAATCGTATTGAC
CTTGATGTCAACAAACAAAGATTCGAGAAAAAAAAGAAAAAACAACATAAATTCCTTCAG
AACTTAAAAGAATCTTCAAAGTCTCGGGGATTCTTTTTCGATAAAAACTTACCAAAAAAA
AAGTCTAGCAAGAAAATATCAATGGGATTTAATTTCACAAATACAAATGAAGAAATCAAA
CTGATTGCAAATGTTACTCCAGATATTGAGTGGTGGGATAAAGAAATTACAAACTCTTAT
AGCGAGTTATATAATCCAGATGCAATAACTGCAGAAATATTCAATGCAACTTTACCTATT
CAGCTACCTTTTAATACAACAACACATAATGTTACAATGCATTTGACTGAAAAAGAAAAA
AAGAAAATCAAAAGACTAAAAAAAGCACAGAAACTTAAAGAAATTAGAGAAAAAATCAAA
CTAGGCCTTATGGAAGCCCCTCCAGCGAAAATTAAAATAAGCTCACTTATGAGAGTGATG
TCAAGAGAATTAGCTCAAGACCCTAGTAAAACAGAACATGAAATAATGGAAAAATACAAT
GAAAGATTACAAAAACATATAGCTAGGAATGAAGAAAGTAAACTAACACATGCACAAAGA
GTTGAAAAAGCATTACGTAAACGAAGAAGAGATAGTGCAAGAGAGTCTAGAATCGCTGTA
TTCAAAATATCTTATTTTTCAAGTACAAAAATAAAATTCAAGCTTATGAAAAATGCAAGT
CAATTAGCTTTAGTTGGAATATGTTTAATATTACCAAGTCCATCCCCTAGTATAATTATC
GTTGAAGGAGGTAAACGAGCGATTAAGTTTTATACAAGACTTTGCTTACATAGAATTGAT
TGGAAATCCGATAACTCATCATGTGAATTAGTTTGGAATACTGAAATTAAAGATGCGAAG
TTTTTCAAGTTTAAGATTCTTAGTGTAGAATCTGAATTAGATTTAAAAAGAATACTAAGC
AAAAAAGATGCTATGAATTATTGGAGTTTAGTTTGCACATGGAAAGGAAACAACGATATG
TTGCTATAG