Identifiers and Description

Gene Model Identifier

SteCoe_9184

Standard Name

None

Aliases

None

Description

Proteasome domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

  • proteolysis involved in cellular protein catabolic process (IEA) | GO:0051603

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_005481602.3802664086944007e-2620S proteasome core beta subun
it 7
Oxytricha TrifallaxContig22487.0.g856.47023492564546e-26Proteasome subunit

Saccharomyces CerevisiaeYFR050C2.3195228302435696e-16Beta 7 subunit of the 20S prot
easome
WormBaseWBGene000039530.0000000000018795288165390832

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9184(Protein)
MEKSATVSPILTGSSVIAVKYSDGILMCTDTLASYGSMAMFKEIPRMAAIGKSTLIGASG
EYSDFQEIIRILRQKDTDDFIEHDGITLNAGHFASYISSVMYGKRNKGNPLYNSLLMGGF
VNSQPYLAYIDLYGTHILGDYHVTGFAHYISKPIIAAEWRPDLTEEEAKILIEKGMKVLW
YRDARASDRIQFAKITRNGVEFDDPYKFNSDWDQESFKNYSLNPLYPYN


>SteCoe_9184(CDS)
ATGGAAAAATCCGCCACTGTATCTCCAATCCTCACCGGCAGTAGTGTAATAGCAGTCAAA
TACTCTGACGGTATTCTAATGTGTACAGACACTCTTGCCTCATATGGAAGTATGGCAATG
TTCAAAGAAATCCCAAGAATGGCAGCAATTGGTAAGTCAACTCTTATCGGAGCAAGTGGT
GAATACTCAGACTTCCAAGAAATAATTCGTATTCTCAGACAAAAAGATACTGATGACTTC
ATTGAACACGATGGAATAACCTTAAATGCTGGGCATTTTGCTTCATACATAAGCTCAGTC
ATGTATGGTAAACGAAACAAAGGTAATCCTCTTTATAACTCTTTACTTATGGGAGGTTTT
GTCAATTCTCAACCTTATCTAGCTTATATTGACTTATATGGTACGCATATACTAGGTGAT
TATCATGTTACTGGTTTCGCTCATTATATAAGCAAACCTATAATCGCAGCAGAATGGCGT
CCTGATTTAACTGAAGAAGAAGCTAAAATACTTATTGAAAAAGGTATGAAAGTTCTTTGG
TATAGAGATGCAAGGGCAAGTGATAGGATTCAATTCGCTAAAATTACTAGAAATGGTGTG
GAATTCGATGATCCATACAAGTTTAATAGTGATTGGGACCAAGAAAGCTTTAAAAACTAC
TCACTCAATCCTTTATACCCTTACAATTAG