Identifiers and Description

Gene Model Identifier

SteCoe_9224

Standard Name

None

Aliases

None

Description

cNMP_binding domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_007521006.305116760146989e-16cyclic nucleotide-binding doma
in containing protein
Oxytricha TrifallaxContig9480.0.g596.305116760146989e-16Cyclic nucleotide-binding doma
in

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9224(Protein)
MLSNINIEEVIKICSKRPHERTVPDICYLEDLTKSLKVFKNIIETNGPSSHFLCCKFLKY
QYCEIGEYLFKLGDTGTRFYIIMEGIVGVEVQMTNPKGESHMVEVTSLNSGSSFGELALE
NNKPRAASIRCRTKSHFIYLEKSDYERLVSRMIIEKRASLVNFLQALPLFKGYTKGKLTK
LTYIFREKTYNKGQYVYSEGEISEEIFIVKDGEFEIYKPIKKHQARTFADHHGVLKNKVK
KVQNLGRGEIFGETEVFWDCKRVYSCKCSHGPSCVFAVNKIEFFKNVQDEETLELFRKQM
AAKEKAIHKRVEILEKIEEDITSYNKNAEIHSIKAKTNIDNENLEIPVLNSTKASFGQSL
HPIHKKHVSEIFLTKALPHNYRSGSQLPELNTLNQSQKKLPKPLIFISPTIKLRLNKNKY
LPRPLNDKLFESEVHFNVYSFKH


>SteCoe_9224(CDS)
ATGCTCAGCAATATAAACATCGAGGAAGTTATCAAAATTTGTAGCAAACGTCCTCATGAA
CGAACTGTCCCTGATATTTGTTATCTCGAAGATCTAACAAAGTCTTTAAAAGTATTTAAA
AACATTATAGAAACCAATGGGCCATCCTCTCACTTTCTCTGCTGTAAATTCCTCAAATAT
CAATACTGTGAAATAGGCGAATATCTGTTTAAGCTTGGTGATACTGGGACAAGATTCTAC
ATCATAATGGAAGGTATAGTAGGTGTTGAGGTCCAAATGACAAACCCAAAGGGTGAGTCT
CATATGGTTGAAGTAACATCTCTTAATAGTGGTTCATCTTTTGGAGAGTTAGCTTTAGAA
AACAACAAACCCAGAGCAGCTTCAATCCGTTGCAGAACCAAATCACATTTTATATACTTA
GAAAAATCTGATTATGAAAGATTAGTTTCAAGAATGATAATAGAAAAACGTGCATCATTA
GTAAATTTTTTACAAGCTTTACCTTTATTTAAAGGTTACACAAAAGGTAAATTGACAAAA
CTAACTTATATATTCAGAGAAAAAACATATAATAAAGGTCAATATGTATATTCTGAAGGT
GAAATATCTGAAGAGATTTTTATAGTAAAAGATGGGGAATTCGAAATATATAAACCTATA
AAAAAGCATCAGGCTAGAACATTTGCTGATCACCATGGGGTGTTAAAAAATAAAGTGAAA
AAAGTTCAAAATTTGGGTCGAGGGGAAATTTTTGGTGAGACTGAAGTGTTTTGGGATTGC
AAAAGGGTGTATTCATGCAAATGTAGTCATGGCCCTTCTTGTGTTTTTGCAGTTAACAAA
ATCGAGTTTTTCAAGAATGTTCAAGACGAAGAGACCCTTGAACTATTCCGCAAGCAAATG
GCAGCTAAAGAAAAAGCGATACATAAACGAGTTGAAATACTAGAAAAAATTGAAGAGGAT
ATCACATCTTATAATAAAAATGCCGAAATACATTCTATAAAAGCTAAAACTAACATAGAC
AATGAAAATTTAGAAATACCAGTTTTAAACTCGACAAAAGCTTCATTTGGACAATCCTTA
CATCCAATCCACAAAAAACACGTTTCTGAGATTTTTTTAACTAAAGCTCTTCCTCACAAT
TATCGTTCAGGGTCTCAATTGCCAGAACTTAACACCCTAAACCAGTCGCAAAAAAAACTC
CCAAAACCACTGATTTTCATATCCCCAACAATTAAACTTAGGCTCAATAAAAACAAATAC
CTTCCTCGACCTCTAAATGACAAGCTTTTTGAAAGCGAAGTACATTTCAATGTTTACTCC
TTTAAGCATTAA