Identifiers and Description

Gene Model Identifier

SteCoe_9238

Standard Name

None

Aliases

None

Description

RRM_2 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000189870
Tetrahymena ThermophilaTTHERM_007034709.602680054508676e-24RNA recognition motif 2 family
protein
Oxytricha TrifallaxContig6775.0.g211.4251640827409352e-21RNA recognition motif 2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9238(Protein)
MEESHKKRLNVFRAITRDFSPGSFKSECSFEVPESSSLCQLSLSSSSSHQGEGSDYGYSP
ALFTERVQRRLPLAEPGSIPSTKSNIPVRVLANLEPRSACESFHRKAVPSLDARRGEFFL
DTSLNTSGSLSSRSQHLNMSTEESSREDLEERGKPKKRPLEEGERSFYIIKLDCIKNSED
TRTTIMIKNIPNKYTQKMLIQTIDRKFSGTYDFLYLPIDFKNRCNVGYAFINFVDNRVII
PFFHEFNAKRWERFNSEKICALAYARIQGLQELVQHFQNSSVINQEDNKVKPIILAKH


>SteCoe_9238(CDS)
ATGGAAGAGTCTCATAAAAAGCGTCTCAACGTTTTTAGAGCTATCACTCGAGATTTTTCC
CCAGGATCCTTTAAAAGTGAATGCAGTTTCGAAGTTCCAGAATCCTCATCACTTTGTCAA
CTATCCTTATCCAGTAGTTCTTCTCATCAAGGTGAAGGGTCTGACTATGGATATTCCCCT
GCACTTTTTACTGAAAGGGTCCAAAGACGCCTTCCTTTAGCAGAGCCTGGCAGTATTCCA
AGTACAAAATCTAACATTCCAGTTCGAGTTTTAGCTAACTTAGAACCAAGGAGCGCTTGT
GAATCTTTTCATAGAAAAGCAGTGCCTAGCCTTGACGCTAGGAGGGGTGAGTTTTTTCTC
GACACATCTCTTAATACCAGTGGGAGTTTATCAAGTAGAAGCCAACACCTAAATATGAGT
ACTGAAGAATCAAGTAGAGAAGACTTAGAAGAAAGAGGAAAACCTAAAAAACGACCACTT
GAAGAAGGAGAACGTAGTTTCTATATAATAAAACTTGACTGTATAAAAAACAGTGAAGAT
ACAAGAACTACTATAATGATCAAAAATATCCCAAATAAATATACACAAAAAATGCTTATC
CAAACCATCGACAGAAAATTCTCAGGGACTTATGATTTCTTATACCTTCCTATTGACTTT
AAAAATCGATGCAATGTAGGGTATGCATTTATTAATTTTGTGGACAATAGAGTGATTATC
CCATTTTTCCATGAGTTTAATGCCAAGCGGTGGGAAAGATTTAATTCAGAAAAAATCTGC
GCATTGGCTTATGCGAGGATTCAAGGATTGCAGGAGCTGGTTCAGCATTTTCAGAATTCT
TCAGTAATTAACCAGGAGGATAATAAGGTTAAGCCAATAATCCTCGCAAAACATTAG