Identifiers and Description

Gene Model Identifier

SteCoe_9278

Standard Name

None

Aliases

None

Description

RNA_pol_Rpb1_1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17704.0.g320RNA polymerase Rpb1, domain 5

WormBaseWBGene000129994.961148436415422e-78

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9278(Protein)
MARSFSKKLDSVEFGFYSAEEAKKLGAVEITSISVYEPIKKPIKSSKAKDPKDLKDPNDT
VKPEVIRKPMQGGLADPRLGVSLNSRLNAETCVVCNQDPNSCQGHLGYISLCTPAYNPFA
FDILYKLLKSKCAFCHRLKLPNEKSHMYILKKQLIKRGKLLDALSLEDLLSDKFISDSEI
DKFDEIRDIIMAQKDLYEDIAIESANCGESEAFSILIKASNDIDTQIWKNFSGRICAHCN
EKQPKIVKEGDCKIFRVPLKDKEIRALELKGKTSEVNKIVMTAEMVYEELRCTWEHDKDV
LTELLNGKAMDAMFMHKLIVTPNRFRPESKGTTGMQTYMNVQSVSLSRIMILNEKILNQK
AKNEDFSETFFEFQHAINMYMDSSNWARQSEKDLAGLRQLLEKKEGLFRLKMMGKRVNYA
ARSVISPDPYINTGEIGIPIVFAKRLTFPEPVRENNLEYLRKLVENGPNVHPGANMIEEA
DGKKIILDKFSQKQLKGVAARLFTGGIGKTVYRHLQTGDWLLVNRQPTLHKPSMMAHSAR
VLPKQTTIRMHYSNCNTYNADFDGDEINLHFFQSHLARSEAKHIASTDYQYTAPTSGKPL
RGLIQDHVVSGVLLTCKDTFLERDEYMQLIYIASQHLKKTIQIPPCILKPKVLWSGKQVI
STIIQTLSYGKFQMNLNEKCKVGGYMWGKSSIEEEMLLIKDGYICTGILDKNHIGNVEYG
LVHSFHELYGESAAAQLLTSLGRVLTLYLQMIGFSCTMDDLILTPGSNDKRTNSIQNTES
KTVEYAHEVINITPSKHSNNQISKKLLKGLENFLLENEDNSKELDLKMISFVKKSLSDIQ
KNLIPEGLKKKFPYNNFSAMVTTGAKGSLVNHQQVSLMLGQQELEGRRVPLTALGKSAPS
FDAYDPTPRAGGLVTDRFLTGIKPQDFFFHCMAGREGLVDTAVKTSRSGYLQRCLIKGLE
SLIVAYDYTVRDSDGSIIQFLYGEDCIDPSKNKYVRAFEFLNENSLALCEKLKFSECSEK
LDFTQIPKFESFDANQKWDTSLNAHTPGKIGSMSTKXDANQKWDTSLNAHTPGKIGSMST
KMYELCNKYIGDKKDMRKKNKSLPRISKSNFMTMISMKYMSSLIQPGEXYELCNKYIGDK
KDMRKKNKSLPRISKSNFMTMISMKYMSSLIQPGESVGIIASQSIGEPSTQLTLNTFHLA
GHGSANVTLGIPRLREILMTASATIKTPIMILPFNGSKEAAENFKNHIQKISFKYLVKKI
KIIEKVNPKINKRTYIAKIAFEDKDIIEETIGLSWEFINSRVQNALIPAIDSAISHKIKK
SDLKTALVFEEKKEESVENAAKKQEKVQTVEAEDAKGKKKEINTYENESEELVSEHEPME
VEKEEVSDFKCLKKCTKSDKNSYFKVIFEVPMKYNILVLSEIEKQLECTYLRELHGIGRC
HVDEKKDQVTITTEGVNFHEIWKYDELFNLKKARSNDIVAVLKTYGVEAAAKTIINEVYT
IFDNYGISVDKRHLTLIADFMTFNGGYRPFNRFGMNENPSPLLRMSYETTMNYLSDSALT
GQIDLGKTPSACIVLGKPARIGTNYMDVFQVLNS


>SteCoe_9278(CDS)
ATGGCAAGGTCTTTTTCAAAGAAGCTTGATAGTGTTGAATTCGGTTTCTACTCTGCCGAA
GAAGCCAAAAAGCTCGGCGCAGTAGAAATCACATCCATCAGTGTCTATGAGCCAATCAAA
AAGCCTATAAAGTCCTCTAAAGCAAAAGACCCAAAAGATCTTAAAGACCCAAACGATACA
GTTAAACCAGAAGTAATAAGAAAACCAATGCAAGGAGGTTTAGCCGACCCAAGACTTGGC
GTGTCTTTAAACTCTCGTCTTAACGCCGAAACATGTGTTGTTTGTAATCAAGACCCAAAT
TCTTGTCAAGGTCATTTAGGGTATATATCTTTATGTACTCCAGCTTATAATCCATTTGCC
TTTGATATCCTATATAAACTTCTCAAATCCAAATGCGCCTTTTGTCATCGTCTTAAGCTG
CCAAATGAAAAATCACATATGTACATACTAAAAAAACAGCTTATCAAAAGAGGTAAGCTT
TTAGATGCTTTAAGCTTAGAAGACCTGCTTTCTGATAAGTTTATTTCCGACTCAGAAATC
GATAAATTTGACGAAATTAGAGACATAATCATGGCACAAAAAGATTTATATGAAGATATC
GCTATAGAAAGCGCCAATTGTGGAGAATCTGAAGCTTTTAGCATTTTAATCAAAGCTTCA
AATGATATCGACACTCAGATTTGGAAGAATTTTTCAGGAAGGATCTGCGCTCATTGCAAT
GAAAAGCAGCCTAAAATAGTAAAAGAAGGGGATTGTAAAATATTCCGTGTACCTTTAAAA
GACAAGGAAATCAGAGCTCTTGAACTTAAAGGAAAAACATCTGAGGTTAATAAAATTGTC
ATGACGGCTGAAATGGTTTATGAAGAACTTAGATGTACTTGGGAACATGATAAAGATGTA
TTGACTGAGCTTTTAAATGGTAAAGCTATGGATGCGATGTTTATGCATAAGCTTATTGTT
ACACCAAATAGATTTAGACCTGAGAGTAAAGGGACAACAGGGATGCAAACTTATATGAAT
GTACAGAGTGTGTCACTTAGTAGGATAATGATTTTGAATGAGAAAATCCTTAACCAAAAA
GCTAAAAATGAAGACTTTTCTGAAACATTTTTTGAGTTCCAACACGCGATCAACATGTAT
ATGGACTCTTCAAATTGGGCAAGACAAAGTGAGAAGGATTTAGCTGGGTTAAGACAATTA
TTAGAGAAAAAAGAAGGGCTTTTCAGATTAAAAATGATGGGAAAAAGGGTTAACTATGCA
GCTAGGAGTGTTATTTCCCCTGACCCTTATATAAATACTGGAGAAATCGGTATCCCAATT
GTTTTTGCTAAAAGACTGACTTTCCCAGAGCCAGTAAGAGAAAATAATCTTGAGTATTTA
AGAAAACTTGTTGAAAATGGACCGAATGTGCATCCTGGAGCAAATATGATTGAAGAAGCA
GATGGGAAAAAAATTATACTTGACAAGTTCTCACAAAAACAGCTTAAAGGTGTTGCGGCA
AGGCTTTTTACTGGAGGAATCGGGAAAACTGTATATAGGCATTTACAAACTGGGGATTGG
CTTTTAGTTAATAGACAGCCAACTTTACATAAACCTAGTATGATGGCTCATTCAGCAAGA
GTGTTACCTAAACAGACAACAATTAGAATGCATTATTCGAATTGTAACACTTATAATGCA
GATTTTGATGGAGATGAGATTAACCTGCACTTTTTCCAGTCGCATTTGGCTAGGTCGGAA
GCTAAACATATAGCATCAACTGATTATCAGTATACAGCACCAACAAGTGGCAAGCCTTTG
CGTGGGCTGATCCAAGACCATGTAGTAAGCGGTGTTTTATTAACATGCAAAGACACATTT
CTAGAACGTGATGAATACATGCAGCTTATTTACATAGCATCACAGCATTTGAAAAAAACA
ATTCAAATCCCCCCTTGTATACTAAAACCTAAAGTCCTTTGGTCAGGAAAGCAAGTAATC
TCAACAATAATTCAAACTTTATCTTATGGTAAATTCCAAATGAATCTTAATGAAAAATGT
AAAGTCGGAGGATATATGTGGGGTAAATCTAGTATCGAAGAAGAAATGCTTCTAATAAAA
GATGGTTACATTTGTACTGGAATATTAGATAAGAACCATATTGGTAATGTTGAATATGGC
CTAGTCCACAGTTTCCATGAGCTTTATGGCGAGTCAGCTGCAGCTCAACTTCTAACATCT
TTAGGCCGAGTACTTACATTATACCTACAAATGATAGGCTTTTCTTGTACAATGGATGAC
TTAATATTAACCCCAGGATCTAATGATAAACGTACTAACAGCATTCAAAACACAGAATCT
AAGACTGTAGAATACGCTCATGAAGTTATCAATATAACCCCTTCAAAACATTCAAATAAT
CAAATTAGCAAGAAACTTTTAAAAGGACTCGAGAATTTTTTATTAGAAAATGAAGATAAC
AGCAAAGAGCTTGACTTAAAAATGATTTCTTTTGTTAAAAAATCCCTGTCTGATATTCAA
AAAAATCTTATCCCAGAAGGACTTAAAAAGAAATTCCCTTATAATAACTTCAGTGCAATG
GTCACAACAGGTGCTAAAGGTAGTCTTGTAAATCATCAACAAGTAAGCCTTATGCTTGGT
CAACAAGAACTTGAAGGACGTCGTGTACCTTTAACTGCTTTAGGTAAAAGTGCACCAAGT
TTTGATGCTTATGACCCAACACCTAGAGCTGGAGGATTAGTAACAGATCGTTTTTTAACT
GGAATTAAACCTCAAGATTTTTTTTTCCATTGTATGGCTGGAAGAGAAGGATTAGTAGAT
ACTGCTGTTAAAACAAGTCGTAGTGGGTATTTACAAAGATGTTTAATCAAAGGTTTAGAA
AGTTTGATTGTTGCTTATGATTATACGGTTAGGGATTCAGATGGGTCAATAATCCAGTTT
TTATATGGAGAAGATTGTATTGATCCTTCAAAAAATAAGTATGTTCGAGCTTTTGAGTTT
TTGAATGAAAATTCACTTGCTTTGTGTGAAAAACTTAAGTTTTCTGAGTGTTCAGAAAAA
CTGGATTTTACTCAGATACCGAAGTTTGAGAGTTTTGATGCGAATCAGAAGTGGGATACA
TCGTTAAATGCGCATACACCTGGGAAAATAGGGAGTATGTCGACTAAGATNGATGCGAAT
CAGAAGTGGGATACATCGTTAAATGCGCATACACCTGGGAAAATAGGGAGTATGTCGACT
AAGATGTATGAACTTTGTAATAAATATATTGGGGATAAAAAGGATATGAGGAAAAAAAAT
AAAAGTCTGCCGAGGATAAGCAAATCGAATTTTATGACTATGATTAGTATGAAGTATATG
AGCAGCTTGATACAACCTGGGGAGNTGTATGAACTTTGTAATAAATATATTGGGGATAAA
AAGGATATGAGGAAAAAAAATAAAAGTCTACCGAGGATAAGCAAATCGAATTTTATGACT
ATGATTAGTATGAAGTATATGAGCAGCTTGATACAACCTGGGGAATCCGTAGGGATTATA
GCTTCACAATCTATTGGAGAACCTTCAACTCAGCTAACCTTAAATACCTTCCATTTAGCA
GGTCATGGTAGCGCCAACGTTACTTTAGGTATTCCACGTCTTAGAGAAATCCTCATGACT
GCATCTGCAACAATAAAAACCCCAATTATGATCCTACCATTCAACGGCTCTAAAGAAGCA
GCTGAGAATTTCAAAAACCACATCCAAAAAATTTCTTTCAAATATCTCGTAAAAAAAATC
AAAATCATAGAAAAAGTTAACCCAAAAATCAATAAAAGGACTTATATAGCGAAAATTGCA
TTTGAAGATAAAGATATTATAGAAGAGACAATTGGGTTAAGCTGGGAATTTATAAACTCA
AGGGTTCAGAATGCTTTGATTCCAGCTATAGATTCAGCAATTTCTCATAAAATCAAAAAA
TCAGACTTGAAAACTGCACTTGTTTTTGAAGAGAAAAAGGAAGAAAGTGTTGAAAATGCG
GCAAAAAAACAGGAAAAAGTTCAAACGGTTGAAGCTGAAGATGCTAAAGGTAAGAAAAAG
GAAATAAATACTTATGAAAATGAGTCTGAAGAATTGGTTAGTGAGCATGAGCCGATGGAA
GTGGAAAAAGAGGAGGTTTCTGATTTTAAGTGCTTGAAAAAATGTACGAAAAGCGATAAA
AACAGTTATTTTAAAGTGATATTTGAAGTACCGATGAAATATAACATACTCGTTTTGTCT
GAAATCGAAAAACAACTCGAATGCACGTATTTGCGCGAACTCCACGGGATCGGCCGATGC
CACGTCGATGAAAAAAAAGACCAGGTGACAATTACAACAGAAGGGGTTAATTTCCATGAA
ATTTGGAAATACGACGAGCTTTTTAACTTGAAAAAAGCGCGATCAAACGACATTGTCGCT
GTTTTAAAAACATATGGCGTTGAAGCTGCAGCTAAAACTATAATCAATGAAGTATATACA
ATTTTTGACAATTATGGAATCAGTGTAGATAAAAGACATTTGACACTTATTGCTGACTTT
ATGACTTTTAATGGTGGGTATAGACCTTTTAATAGATTTGGGATGAATGAAAACCCTAGT
CCTTTGTTGAGGATGAGCTATGAAACTACTATGAATTACCTTTCTGACTCAGCATTAACT
GGGCAGATTGACCTTGGGAAGACCCCTTCAGCGTGTATTGTTTTAGGCAAACCTGCGAGA
ATTGGGACGAATTATATGGATGTATTTCAGGTTTTAAATAGCTAA