Identifiers and Description

Gene Model Identifier

SteCoe_9284

Standard Name

None

Aliases

None

Description

Actin domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig7469.0.g372.1151310375910805e-19Actin

Tetrahymena ThermophilaTTHERM_003119804.248354255291589e-18actin-related protein
Saccharomyces CerevisiaeYOR141C0.0000000001026187963170189Nuclear actin-related protein
involved in chromatin remodeli
ng; component of chromatin-rem
odeling enzyme complexes; has
mRNA binding activity

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9284(Protein)
MENKSSETIVIQLGSLNLRVGFGNQMQPYTIPNVIAYRGSPQVTPYPPCDAETLFKAYSM
VQNYLLSTGFLKDHIPKIVLPTKKKAKAKPVDEEDGESEIEIFAISEYTDTGHHPGFFVG
EEAYNLAPNENYTKHWPIARGHFNITPNQSFRTVLGDLERILEYTAIRILKIPREMFQQF
SIVLIIPDAFYKDQVKALVDILLRNLGFRSIFIQQESVSAIFGAGVPSACVVDIGASHVN
VICVDEGVELPKTHIRQYYAGKDIDLLLMRILTRPESESPDQLRLVEALKKDACRLMQQE
NQVSYICRAKNSMLKVGSTNPALAVAAHSLFHTSLLEISSGPPKMPFILHPSLSDTDDYL
DDLIESKIEPLPHPTQENKILSLDQLIIKSILALETPDLKKKMANCILLTGGGGMFPDLV
DILEDRLINRFPEEGGVDRVEVKASITHSDSEGNKEHIRPDHLIWVGGTVIPNLESAKEL
WISRARWVGEWQPTEAKEELMANFVSFDNHYQLAEMCRKWRRDRPLEGGVRLIREKSTFI
W


>SteCoe_9284(CDS)
ATGGAAAACAAAAGTTCAGAAACCATAGTAATCCAACTTGGTTCTCTGAATCTTCGTGTA
GGGTTCGGTAATCAAATGCAGCCATATACAATCCCAAATGTTATTGCATATAGAGGTAGT
CCTCAAGTAACTCCATATCCTCCATGTGATGCTGAAACTTTATTCAAAGCTTATTCCATG
GTTCAGAATTATTTATTAAGTACAGGTTTTCTTAAGGATCATATACCAAAAATTGTCCTT
CCAACTAAGAAAAAAGCTAAAGCTAAACCTGTTGATGAAGAAGATGGGGAGTCAGAAATT
GAAATTTTTGCTATTTCTGAATATACAGATACAGGACATCATCCAGGGTTTTTTGTTGGA
GAAGAAGCTTATAATCTGGCACCAAATGAAAATTATACTAAACATTGGCCTATTGCTAGA
GGACATTTTAATATAACCCCAAATCAGAGTTTTAGGACTGTTTTAGGGGACCTTGAAAGA
ATTTTAGAGTACACGGCGATTAGGATATTAAAAATACCTAGAGAAATGTTCCAGCAGTTT
TCTATTGTATTAATAATCCCTGATGCTTTCTATAAAGATCAAGTTAAAGCTTTAGTTGAT
ATTCTTTTAAGAAACCTAGGCTTTAGGAGTATTTTTATACAACAAGAAAGTGTTTCTGCT
ATTTTCGGTGCTGGGGTTCCTAGTGCGTGTGTTGTTGATATTGGGGCAAGCCATGTAAAT
GTGATTTGTGTAGATGAAGGTGTAGAGCTTCCAAAAACACATATAAGACAGTATTATGCA
GGTAAAGATATCGACCTTTTATTAATGAGAATATTAACTCGGCCTGAGAGTGAGTCTCCA
GATCAATTACGTTTAGTAGAAGCTTTAAAAAAAGATGCTTGTCGATTAATGCAACAAGAA
AATCAAGTCAGTTATATATGCAGAGCCAAAAACTCAATGTTAAAAGTAGGCTCGACAAAT
CCAGCACTTGCTGTTGCTGCTCATTCTTTATTCCACACTTCACTCTTAGAAATTTCTTCA
GGTCCTCCAAAAATGCCTTTTATCCTCCACCCTTCTCTTTCTGATACTGACGATTATCTT
GATGACCTTATTGAATCTAAAATTGAACCTCTTCCACACCCTACACAAGAAAATAAAATC
CTCAGTTTAGATCAGCTGATAATAAAATCGATTCTTGCTCTTGAAACACCTGATCTAAAA
AAAAAAATGGCCAATTGTATCTTATTAACTGGTGGTGGGGGGATGTTTCCTGATTTAGTT
GATATATTAGAAGATCGGCTTATAAATAGATTTCCTGAAGAAGGTGGGGTTGATAGAGTT
GAAGTTAAAGCTAGTATAACTCATTCTGATAGTGAAGGGAATAAAGAACATATAAGACCA
GATCATTTAATATGGGTTGGTGGGACAGTTATACCAAATCTAGAAAGTGCGAAAGAATTA
TGGATTTCAAGGGCTAGATGGGTTGGAGAATGGCAACCTACTGAAGCTAAAGAGGAACTT
ATGGCGAATTTTGTTAGTTTTGATAACCATTACCAGTTAGCCGAGATGTGTAGGAAATGG
AGAAGGGATAGACCACTTGAAGGTGGGGTGAGGTTGATTAGAGAAAAATCGACGTTTATA
TGGTAA