Identifiers and Description

Gene Model Identifier

SteCoe_9396

Standard Name

None

Aliases

None

Description

Band_7 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYGR231C3.720075976020836e-44Subunit of the prohibitin comp
lex (Phb1p-Phb2p); prohibitin
is a 1.2 MDa ring-shaped inner
mitochondrial membrane chaper
one that stabilizes newly synt
hesized proteins; determinant
of replicative life span; invo
lved in mitochondrial segregat
ion; prohibitin deficiency ind
uces a mitochondrial unfolded
protein response (mtUPR)
WormBaseWBGene000040151.6458114310822737e-38
Oxytricha TrifallaxContig14352.0.g524.906094730649281e-35SPFH domain / Band 7 family

Tetrahymena ThermophilaTTHERM_003886405.380186160021138e-32SPFH domain / Band 7 family pr
otein

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9396(Protein)
MQALPIRSIGGIVAFGTFGVLAYNSLFTVEPGQNAIIFNKIFGVKDFTYPEGTHIKIPLI
ENPIFYNIRPHPEVINSLTGTRDLQMVNVSIRVLCKPVAHNLPTIYRTLGKDYDKRVLPS
IVNEVLKSVVAQYNASQLVTQREQISRTIRQNLISRANDFNIVVDDVSITNLNFSNEFNA
AIESKQIAQQHAERAKYIVQSATQEKLGMIVRAQGEAKSAELLGSVGPAYVKLRKLETAQ
EIANSIANSRNRVLLDSNNLMMNLKNLLD


>SteCoe_9396(CDS)
ATGCAAGCTCTGCCAATCCGTTCCATAGGAGGAATCGTAGCTTTCGGGACTTTCGGTGTA
CTAGCCTATAACTCGCTTTTTACAGTCGAGCCAGGGCAAAATGCAATAATTTTCAACAAA
ATCTTCGGAGTCAAAGATTTCACATACCCTGAAGGCACACATATAAAAATTCCTCTAATA
GAAAATCCAATATTCTACAACATCAGGCCACATCCTGAAGTTATTAATTCACTTACAGGT
ACTCGCGATTTACAAATGGTCAACGTATCTATCAGAGTCTTATGTAAACCTGTTGCTCAT
AATCTTCCAACAATTTACAGGACTTTAGGTAAAGATTATGATAAAAGAGTTCTCCCAAGT
ATTGTAAATGAAGTTTTAAAATCTGTTGTTGCTCAATATAATGCTTCTCAACTTGTCACT
CAAAGAGAACAAATTTCTAGGACTATTAGACAAAATCTTATTTCTAGAGCTAATGATTTT
AATATTGTTGTTGATGATGTGAGTATAACAAATTTGAATTTTAGTAATGAATTTAATGCT
GCTATTGAATCAAAGCAAATTGCCCAACAACATGCTGAAAGGGCAAAGTATATTGTCCAG
AGCGCCACTCAGGAAAAGCTTGGGATGATTGTTAGAGCTCAAGGAGAAGCTAAAAGTGCT
GAATTGTTAGGATCAGTTGGACCTGCTTATGTGAAACTAAGAAAACTTGAAACAGCTCAA
GAGATTGCCAATTCTATTGCCAACTCGAGGAATAGAGTTTTGCTTGATTCGAATAATCTT
ATGATGAATCTTAAGAACTTATTAGATTAA