Identifiers and Description

Gene Model Identifier

SteCoe_9413

Standard Name

None

Aliases

None

Description

Aurora family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig13183.0.g971.2479464629129513e-47Protein kinase domain

Tetrahymena ThermophilaTTHERM_003342807.47197233734299e-43Streptococcal surface antigen
repeat family protein. Sequenc
e similarity to the Aurora pro
tein kinase family (Eisen et a
l., 2006)."
WormBaseWBGene000000993.975449735908647e-31
Saccharomyces CerevisiaeYPL209C3.221340285992516e-27Aurora kinase of conserved chr
omosomal passenger complex; me
diates release on mono-oriente
d kinetochores from microtubul
es in meiosis I, also release
of kinetochores from cluster a
t SPBs at meiosis exit; helps
maintain condensed chromosomes
during anaphase, early teloph
ase; required for SPB cohesion
and prevention of multipolar
spindle formation; Iocalizes t
o nuclear foci that diffuse up
on DNA replication stress; req
uired for inhibition of karyop
herin Pse1p upon SAC arrest

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9413(Protein)
MSSAKNKRRMLFPSPSVLNGAEKEPNVSDFESLTKKALGEGAFGEVYKVRHKISRELYAI
KVVNKTKVVDANLLPQLRREIRIMYSLNHPHVIKLYNHFEDDNNFYLVLELAEGGTVFQK
LAKFKSFDEAASAQYMREVILAVEYLHSRDPPIIHRDIKPENLLLDKEGRDGRIKVADFG
WSNFFNPDRSRMTYCGTLDYLAPEMINQQGHSTNLDLWNLGVLLFELLTGSAPFQASNQA
AMFEKILKVRITFPKNFPPFAKDLIMKLLKANPDERIPLGEILSHPWMQTHQPIRPTMTQ
QVIKEPLPCTFDTNIDPEIIEDPIKPFCEGEYKVLSKPSTKKEEEKKTPEVLMPAPIPSA
YTQQVSTLETELKQTRDENKKYRSQLEDKEAELERVKGKIGELEGVLSKLESECDEKRKV
EKNLKEQLTEKTNKISELKALQEDENKLYQEYENLRAKCLEKETELSLLKTEIENMEKLA
KEKVQQTEQIEKEIEKVKNEIDQTKQKYSRTKSEMHDQFLKLSTEVDVLQKELQSKERDS
SVISLEALLTFTQDNLEILKKRSRLENDLLKQYQDANERLIQLDNKYTEMKIQYENDLVE
LRRKTDNELRELEANTVKIVEPAPEADLDILVQRLKESLENQYRNKAMYDELXV


>SteCoe_9413(CDS)
ATGAGTTCAGCTAAAAACAAACGTAGGATGTTATTCCCATCACCAAGTGTTCTTAACGGA
GCTGAAAAGGAACCGAATGTTTCCGATTTCGAGTCACTAACAAAAAAAGCTTTAGGAGAA
GGTGCTTTTGGTGAAGTATACAAAGTCAGACACAAAATTTCTCGTGAACTTTACGCTATA
AAAGTTGTAAATAAAACTAAAGTCGTCGATGCAAACTTATTACCCCAATTACGTCGTGAA
ATCCGTATAATGTATAGTTTAAATCATCCACATGTAATAAAACTTTACAATCATTTTGAA
GATGACAACAATTTTTATTTAGTATTAGAATTAGCTGAAGGTGGGACTGTATTTCAGAAA
CTAGCTAAATTTAAATCTTTTGATGAAGCAGCTTCAGCACAATATATGAGAGAAGTTATT
TTAGCTGTTGAATATTTACATTCAAGAGACCCACCAATTATTCATAGAGATATAAAACCA
GAGAATTTATTATTAGATAAAGAAGGTCGTGATGGGCGTATAAAAGTTGCTGATTTCGGT
TGGTCGAATTTTTTTAATCCAGATCGATCTAGGATGACATATTGTGGAACATTAGATTAT
TTAGCACCTGAGATGATTAATCAACAAGGTCATTCAACTAATTTGGATTTATGGAATTTA
GGGGTTTTACTTTTTGAATTACTTACTGGAAGTGCACCTTTTCAAGCTAGTAACCAAGCT
GCGATGTTTGAGAAAATACTTAAAGTTAGGATTACGTTTCCGAAAAATTTCCCCCCATTT
GCTAAGGATTTGATTATGAAACTTCTTAAAGCTAACCCTGATGAAAGAATACCTTTAGGT
GAAATATTATCACATCCTTGGATGCAAACACATCAACCTATAAGACCAACTATGACCCAA
CAAGTTATTAAAGAACCTTTACCATGTACATTTGATACTAATATTGACCCTGAGATTATT
GAAGATCCTATAAAACCTTTTTGTGAAGGGGAGTATAAAGTTTTATCAAAACCCTCAACT
AAAAAAGAAGAAGAGAAAAAAACTCCAGAAGTTCTTATGCCGGCACCTATTCCTTCAGCT
TATACCCAACAAGTTTCTACTTTAGAAACTGAACTTAAGCAAACTCGTGATGAAAACAAA
AAATACAGGTCACAACTTGAAGATAAAGAAGCTGAACTTGAAAGAGTTAAAGGCAAAATT
GGAGAACTTGAAGGAGTTTTAAGCAAATTAGAATCAGAATGCGATGAAAAACGTAAAGTC
GAAAAAAACCTTAAAGAGCAACTAACAGAAAAAACTAATAAAATCTCTGAACTTAAAGCT
TTGCAAGAAGATGAGAATAAGTTATATCAAGAATATGAAAACCTTAGAGCTAAATGCTTA
GAAAAAGAAACTGAACTTTCTTTATTAAAAACAGAAATTGAAAACATGGAAAAACTAGCT
AAAGAAAAAGTCCAACAAACAGAACAAATTGAAAAAGAAATCGAAAAAGTTAAAAACGAA
ATCGATCAAACAAAACAAAAATACTCAAGAACGAAATCAGAAATGCATGACCAATTCTTA
AAACTCTCAACTGAAGTTGATGTATTACAAAAAGAACTTCAAAGTAAAGAAAGAGATAGT
TCTGTTATATCTTTAGAAGCTTTATTAACATTTACACAAGATAATTTGGAGATATTGAAA
AAAAGGAGTAGACTAGAAAATGATTTATTAAAACAATATCAAGATGCAAATGAAAGATTG
ATACAACTTGATAATAAATATACGGAAATGAAAATACAATATGAAAATGATTTAGTGGAA
TTAAGAAGAAAAACAGATAATGAGTTAAGAGAATTAGAAGCTAATACTGTGAAGATTGTA
GAACCTGCACCAGAAGCTGATCTTGATATTTTAGTACAAAGGTTGAAAGAGAGTTTAGAA
AATCAATATAGGAATAAAGCTATGTATGATGAATTACANGTTTAG