Identifiers and Description

Gene Model Identifier

SteCoe_9424

Standard Name

None

Aliases

None

Description

DCB domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

  • ARF guanyl-nucleotide exchange factor activity (IEA) | GO:0005086

Biological Process

  • regulation of ARF protein signal transduction (IEA) | GO:0032012

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig10719.0.g520Sec7 domain

Tetrahymena ThermophilaTTHERM_008957805.440559879258653e-75Sec7 domain containing protein
WormBaseWBGene000123861.733141042341547e-58
Saccharomyces CerevisiaeYDR170C1.2479464629129513e-47Guanine nucleotide exchange fa
ctor (GEF) for ADP ribosylatio
n factors; involved in prolife
ration of the Golgi, intra-Gol
gi transport and ER-to-Golgi t
ransport; found in the cytopla
sm and on Golgi-associated coa
ted vesicles

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9424(Protein)
MKDPYFPYIELLSSAIDKICKAIKNKKNKELRDMCTSIIESIKTDHTLDANKYFPVFKAA
LDSKITNVLEISLYYMQKLISHGFLTGNCEDTCSTSETSNQNSQRHPRRLIDSIVEIVCK
CVQEPDDNVQLQVIKTLLTIITSFNCEVHDRTLLEAFRACYHIHITSKNLVNQTTAKATC
TQMMHYVFQRMETNSVSISEEPILLMVKTLLKNLVDDVVLYEDKNENCPLRSVPYVLMPD
DEKYKIVHLVKKINDEGYVSGKFGWCCICRKKADFYCKDLRDPICSEVCKKVHRKNIDAA
ERCLVGDENNDYLLDAVLIFRSICKLSLKELPTTTQSLTFKSKVLSLELILAVIDNPGPA
FSSRKQFMDIIRGTLCESLLANSVSSERIIFTLSLSIFVAMVNNFKDSLKIEIGVFLEHI
FIKILESENASYHQKLLVIEVFYNITQNPKTTLELFLNYDCDVEEKDIFGRIISILGKIA
VGKNKLDSTAQQQENNLKHTSLETLVSIVTSQAAWLDKETTYMKTEIQNEDLEESSADIS
DSLLEFEKNKHLKTNISKAVVKFNMKPNLGIKFLHESGYLNSDSPQEIALFLKTTPGINK
TVLGEFFGSKKEPNLSIFHEFVQLFDFKNVGIVEAIRTFLSSFRLPGEGQVVDRIMQKFS
VQFYKDNSLLFEEADAVYVLSFAIIMLQTDLHNVSINKKMPLAQFQIMNAGINKGKDLNP
EYLEDIYNTVKNNKFTLEEDEEAREKLESLGMKRHELYMKETEKMLQKGQKLIKEGRRSS
VYYQAQHIDHLKTMLEALWHPLLATFSIILEEAIEPKLWKLSLQGFLSCIKIACRFSMAL
ELEIFLSSLAKFTSLIYLHNQISEKNIECMKALLEIAKFEANYLKGSWLHVLKCLSKLDH
LHLINSGVKYDGPVTENDILSSESISIQITPGEIDYIFNMSSGLDDDIIIEFVTRLIEIS
REELWGQHPRTFCLQALVNVADVNMNRMRYVWGRVWKTLRDHFSQAGLHKSQFIASFAID
SLKQLAIKFLQKEEFENFHFQKGFLQPFEVIIKNSTNVSVKELVVACMSTFVFTVXLKQL
AIKFLQKEEFENFHFQKGFLQPFEVIIKNSTNVSVKELVVACMSTFVFTVGHNIKSGWGT
IIEVLXT


>SteCoe_9424(CDS)
ATGAAAGACCCTTATTTCCCTTATATCGAGCTTTTATCTTCAGCAATAGACAAAATCTGT
AAAGCAATCAAAAACAAAAAAAACAAAGAACTTCGAGATATGTGCACATCTATCATAGAA
TCCATAAAAACAGATCATACCCTAGACGCAAACAAATATTTTCCAGTCTTCAAAGCCGCT
CTTGATTCTAAAATCACAAACGTCCTTGAGATATCTCTTTATTACATGCAAAAGCTCATA
TCCCATGGTTTTCTTACAGGTAATTGTGAAGACACCTGTAGTACATCTGAAACCTCAAAC
CAAAACTCACAGCGACATCCACGAAGATTAATCGATTCTATAGTAGAAATTGTATGTAAA
TGCGTTCAAGAACCTGATGATAATGTTCAATTACAAGTAATAAAAACCTTATTGACTATA
ATAACAAGTTTCAATTGTGAAGTTCATGATAGGACTTTATTAGAAGCATTTCGTGCTTGT
TATCATATTCATATAACTTCAAAAAACTTAGTTAATCAAACTACAGCTAAAGCGACTTGT
ACTCAAATGATGCATTATGTATTTCAAAGAATGGAAACTAATTCAGTGTCTATAAGCGAA
GAGCCTATATTACTTATGGTAAAAACTTTATTGAAAAATTTAGTTGATGATGTTGTTTTA
TATGAAGATAAAAATGAAAATTGTCCTTTACGTAGTGTCCCTTATGTACTTATGCCTGAT
GATGAGAAATATAAGATAGTACATTTGGTAAAAAAGATTAATGATGAAGGTTATGTTTCT
GGGAAATTCGGCTGGTGTTGTATATGTAGAAAAAAAGCAGATTTCTATTGTAAAGATCTT
AGAGACCCGATATGTTCGGAAGTATGTAAAAAAGTTCATAGGAAAAATATAGATGCTGCT
GAAAGATGCTTGGTTGGGGATGAAAATAATGATTATTTGTTAGATGCTGTACTTATTTTT
AGATCGATTTGTAAACTTAGTTTGAAAGAACTACCGACTACTACGCAAAGCTTAACTTTT
AAGTCTAAGGTTTTATCATTAGAACTTATACTTGCGGTTATTGATAACCCTGGTCCTGCT
TTTTCATCTAGAAAACAGTTTATGGATATTATTAGAGGAACATTGTGTGAAAGTTTGCTA
GCGAATTCTGTATCTTCTGAGAGAATTATATTTACTTTATCATTATCGATATTTGTAGCG
ATGGTGAATAATTTTAAGGATAGTTTGAAAATCGAAATTGGGGTTTTCCTTGAACATATT
TTTATTAAAATTCTTGAAAGCGAAAATGCGAGTTATCATCAGAAACTTTTAGTTATTGAA
GTGTTTTATAATATAACTCAAAACCCAAAAACAACTCTAGAGCTTTTCTTGAACTACGAC
TGTGACGTTGAAGAAAAAGATATTTTTGGTAGAATCATCTCAATACTCGGCAAAATCGCT
GTAGGTAAAAATAAACTAGACTCTACAGCCCAGCAACAAGAAAACAATTTAAAGCACACA
TCTTTAGAAACCCTAGTTAGTATAGTTACATCTCAAGCAGCCTGGCTAGATAAAGAAACT
ACTTACATGAAAACTGAAATTCAAAACGAAGATCTCGAAGAATCCTCAGCTGATATCTCA
GACTCTCTTTTAGAATTCGAAAAAAACAAGCATTTAAAAACAAATATTTCTAAAGCAGTA
GTCAAATTTAACATGAAACCAAATCTTGGTATAAAATTCCTCCACGAATCTGGATATCTA
AACTCAGATAGCCCTCAAGAAATCGCATTATTCCTTAAAACCACCCCTGGAATCAACAAA
ACCGTACTTGGCGAGTTTTTCGGGTCTAAAAAAGAACCGAATCTTTCAATATTCCATGAA
TTCGTCCAGCTTTTTGATTTTAAAAATGTTGGTATTGTTGAAGCTATAAGGACTTTTCTC
TCATCTTTTCGTTTACCAGGAGAAGGACAAGTTGTTGATAGGATTATGCAAAAGTTTTCA
GTACAGTTTTATAAAGACAATTCTTTATTATTTGAAGAAGCTGATGCAGTTTATGTATTA
AGTTTTGCTATTATAATGCTTCAAACAGATTTACATAATGTGTCAATTAATAAAAAAATG
CCTTTAGCGCAATTTCAGATAATGAATGCTGGGATTAATAAAGGAAAAGATTTAAACCCT
GAGTATCTTGAAGATATATACAACACAGTGAAAAATAATAAATTTACTTTAGAAGAAGAT
GAAGAGGCAAGGGAAAAACTTGAGAGTTTAGGGATGAAAAGACATGAATTGTATATGAAA
GAAACTGAAAAAATGCTTCAGAAAGGACAAAAGCTTATAAAAGAAGGGAGGAGATCATCT
GTTTATTATCAAGCTCAGCATATTGACCATTTGAAAACCATGTTAGAAGCATTGTGGCAT
CCTTTATTAGCAACATTTTCTATTATTTTAGAAGAAGCTATAGAGCCTAAGCTATGGAAA
CTTAGTCTTCAAGGGTTTTTATCCTGTATAAAAATCGCATGTAGGTTCTCAATGGCTCTT
GAGCTAGAAATTTTCCTCTCTTCCTTAGCTAAATTTACTTCACTCATATACCTTCACAAT
CAAATCTCAGAAAAAAATATTGAATGTATGAAAGCTTTATTAGAAATCGCTAAATTCGAA
GCTAATTATCTTAAAGGCAGCTGGTTACATGTTCTAAAATGTTTATCTAAACTTGATCAT
CTTCATCTTATAAACTCAGGAGTTAAATACGATGGTCCTGTTACAGAAAATGATATTCTC
AGTTCAGAAAGTATATCAATTCAAATAACCCCAGGAGAAATTGATTATATTTTTAACATG
TCTTCTGGTCTTGATGATGATATTATTATAGAATTTGTCACAAGACTTATAGAAATATCT
AGAGAAGAACTATGGGGACAACATCCAAGAACTTTCTGTTTACAAGCTTTAGTCAATGTT
GCAGATGTTAACATGAATCGTATGAGATATGTTTGGGGACGAGTCTGGAAAACTTTACGT
GATCACTTTTCTCAAGCTGGTCTACACAAAAGTCAATTCATCGCATCTTTTGCTATAGAC
TCACTAAAGCAACTTGCTATAAAATTCCTTCAAAAAGAAGAGTTTGAGAATTTCCATTTC
CAAAAAGGCTTCCTTCAACCTTTTGAAGTTATTATAAAAAATAGTACAAATGTTTCAGTT
AAAGAATTAGTTGTTGCTTGTATGAGTACTTTTGTTTTTACAGTTGNACTAAAGCAACTT
GCTATAAAATTCCTTCAAAAAGAAGAGTTTGAGAATTTCCATTTCCAAAAAGGCTTCCTT
CAACCTTTTGAAGTTATTATAAAAAACAGTACAAATGTTTCAGTTAAAGAATTAGTTGTT
GCTTGTATGAGTACTTTTGTTTTTACAGTTGGACATAATATAAAATCAGGATGGGGGACG
ATAATTGAAGTTTTANGGACATAA