Identifiers and Description

Gene Model Identifier

SteCoe_9478

Standard Name

None

Aliases

None

Description

IRE family kinase

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Saccharomyces CerevisiaeYHR079C1.8048513878454153e-35Serine-threonine kinase and en
doribonuclease; transmembrane
protein that mediates the unfo
lded protein response (UPR) by
regulating Hac1p synthesis th
rough HAC1 mRNA splicing; role
in homeostatic adaptation to
ER stress; Kar2p binds inactiv
e Ire1p and releases from it u
pon ER stress
Tetrahymena ThermophilaTTHERM_006410807.281290178321643e-33Protein kinase domain containi
ng protein. Sequence similarit
y to the IRE protein kinase fa
mily (Eisen et al., 2006)."
Oxytricha TrifallaxContig237.1.g1291.9792598779469045e-32Protein kinase domain

WormBaseWBGene000021475.380186160021138e-32

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9478(Protein)
MFFLLISVALAQLALPKQELVLISTLEGKIHALNSLGVYQWTLDTNKPLISSYYSEIAFE
ENPAPLITTLSGEVVEFVNGNFIKLRQNIKDLVERPPDYVRNRIYIGEKSLRAYILDKNS
GDVLGYYENSQQFSQDKTSETITIGLVNYMYSVLDANTMNTIYNISYTELLTLHKTINIH
KTNTDFFSYLQNIDGAITALHSFDTAGELSKEVYIPEYTQKIKLNNVGNNMIYAELVDEN
DEGKNVFALTHEPLLMIEGQIEEKVYWWWVILLLIPLLYGLLKRKKTIQVMKSEAAVETV
EVVEKKKIELFVDKILGHGSQGTTVFEGMFQERPVAVKRMLKNCIKEAKQEVSLLIKADA
HPNVVTFFAWEEDDTFVYLAFEKCVGTLADVVTESIKKKKKGLKIKKIPEILKLLHDSAL
GLSYLHKLNIVHRDIKPMNILIDSKNIAKIADMASGKRLAKDVSSFGTQAHGSSGWQPKE
VLANQRRTKAVDIFSLGCTFYYSLTKGGHPFGSRIQRDNNILSSNYSLKGISNEAKHLIQ
KMIQMDFSKRPQIDYVHQHCLFWSSQIKLNFLQDVSDLLEAEGNGSLLEIELECYCKFMM
DRPWDEVLGAEFIANLGKYRKYDHSSVKDLLRVIRNKMHHFHDMPELLKVLVGPMPDGFF
EFFDKRFPLLFITLFDYLEISGNRLISKYIKI


>SteCoe_9478(CDS)
ATGTTTTTTTTACTTATAAGTGTTGCATTAGCTCAGCTTGCCTTGCCAAAACAAGAGTTA
GTCCTAATCTCAACTTTAGAAGGCAAAATTCATGCATTGAACTCTTTAGGGGTATATCAA
TGGACTTTAGATACAAATAAACCTTTGATATCTTCATATTACTCTGAGATAGCTTTTGAG
GAAAACCCTGCCCCTTTGATCACAACTCTTTCAGGCGAAGTGGTTGAGTTCGTTAATGGG
AATTTTATAAAACTTAGACAGAACATCAAAGACCTCGTAGAACGTCCACCAGACTATGTC
AGAAATCGCATCTATATAGGAGAAAAATCTTTAAGAGCTTATATTCTAGATAAAAACTCA
GGGGATGTTCTTGGTTATTATGAAAACTCGCAACAGTTTTCTCAAGATAAAACCTCAGAA
ACTATTACAATTGGTTTAGTTAATTATATGTACTCAGTACTTGATGCAAATACAATGAAT
ACAATTTACAACATTTCTTATACAGAACTCTTAACACTTCATAAAACTATAAACATACAT
AAAACAAATACTGACTTTTTTTCATACCTTCAAAATATAGACGGGGCGATAACTGCATTA
CATTCTTTTGATACTGCAGGAGAGTTATCTAAAGAAGTTTATATCCCGGAATATACACAA
AAAATCAAACTTAATAATGTTGGGAATAATATGATTTATGCTGAACTTGTTGATGAAAAT
GATGAAGGGAAAAATGTTTTTGCCCTAACACATGAACCTTTACTTATGATTGAAGGTCAG
ATTGAAGAGAAAGTGTATTGGTGGTGGGTAATTTTATTGTTAATACCTTTGTTATATGGG
TTATTGAAAAGAAAAAAAACAATTCAAGTTATGAAAAGTGAAGCAGCGGTTGAGACTGTA
GAAGTTGTAGAAAAGAAAAAAATCGAACTTTTTGTGGATAAAATACTTGGACATGGAAGC
CAAGGGACAACGGTTTTTGAAGGAATGTTTCAAGAAAGACCTGTTGCTGTTAAAAGAATG
TTGAAAAACTGTATAAAAGAAGCTAAACAGGAAGTGTCTTTGCTTATAAAAGCTGATGCC
CATCCTAATGTTGTGACCTTTTTTGCATGGGAGGAAGATGACACTTTTGTATATCTCGCT
TTTGAAAAATGTGTTGGGACTTTAGCTGATGTAGTCACTGAGTCTATAAAAAAGAAAAAA
AAAGGACTGAAAATCAAAAAAATCCCAGAAATCTTAAAACTACTCCATGACTCAGCTTTA
GGTCTTAGTTATCTTCATAAACTTAACATTGTCCATCGTGATATAAAACCAATGAATATA
CTTATAGACAGTAAAAATATTGCAAAAATCGCTGATATGGCCTCAGGAAAACGCTTAGCT
AAAGATGTAAGTTCTTTTGGCACACAAGCTCATGGAAGTTCAGGCTGGCAGCCAAAAGAA
GTCTTAGCAAATCAAAGAAGAACCAAAGCTGTTGATATTTTTTCATTAGGTTGCACATTT
TATTACTCTTTAACTAAAGGAGGTCATCCTTTTGGTAGTAGAATACAAAGAGATAATAAT
ATTCTATCATCGAATTACTCACTTAAAGGTATTAGCAATGAGGCTAAACATTTGATTCAA
AAAATGATTCAAATGGATTTTTCAAAAAGACCACAAATTGATTATGTCCATCAACATTGT
CTTTTTTGGAGTTCACAAATTAAACTTAATTTTTTACAAGATGTTAGTGATTTATTAGAA
GCAGAAGGTAATGGAAGTTTACTTGAAATTGAACTTGAATGCTATTGTAAATTTATGATG
GATAGACCTTGGGATGAAGTTCTTGGGGCTGAGTTTATAGCGAATTTAGGGAAATATAGG
AAATATGATCATAGTTCTGTGAAAGATTTACTTAGGGTTATTAGGAATAAAATGCATCAT
TTTCATGATATGCCTGAACTACTGAAGGTTTTGGTTGGACCTATGCCTGATGGGTTTTTT
GAGTTTTTTGATAAAAGATTCCCATTGCTTTTTATTACTTTGTTTGATTACCTTGAGATT
AGTGGTAATAGGCTTATAAGCAAATATATAAAAATATAA