Identifiers and Description

Gene Model Identifier

SteCoe_9508

Standard Name

None

Aliases

None

Description

EF-hand_7 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_006305001.8521167695179754e-45Calmodulin (CaM); EF hand fami
ly; 1 of 3 proteins similar to
mammalian CaM; uniquely activ
ates ciliary membrane associat
ed guanylate cyclase; regulate
s ciliary dynein ATPase and F-
actin bundling activity of EF-
1 alpha; regulates cytokinesis
Oxytricha TrifallaxContig4133.0.g465.0345753587649823e-45EF hand

WormBaseWBGene000005525.5210822770285325e-42
Saccharomyces CerevisiaeYBR109C7.984904245686979e-30Calmodulin; Ca++ binding prote
in that regulates Ca++ indepen
dent processes (mitosis, bud g
rowth, actin organization, end
ocytosis, etc.) and Ca++ depen
dent processes (stress-activat
ed pathways), targets include
Nuf1p, Myo2p and calcineurin

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9508(Protein)
MAEQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLSLMARKMKDQDTEEELIEAFKVFDRDGNGLISAAELRHVMTNLGEKLTDE
EVDEMIREADLDGDGHINYEEFVRMMMAK


>SteCoe_9508(CDS)
ATGGCAGAACAACTTACTGAAGAACAGATTGCTGAGTTCAAGGAAGCTTTTTCTCTTTTC
GATAAGGACGGTGATGGAACTATCACAACAAAAGAGCTTGGAACTGTCATGAGATCTTTA
GGTCAAAACCCAACTGAAGCTGAACTTCAAGATATGATTAACGAAGTTGATGCTGATGGT
AACGGGACTATTGACTTTCCTGAATTCTTAAGTTTGATGGCTAGGAAAATGAAAGATCAG
GATACTGAAGAAGAACTTATTGAAGCTTTTAAGGTTTTTGATAGAGATGGTAATGGGCTT
ATTAGTGCGGCTGAACTTAGACACGTCATGACTAACCTTGGTGAGAAACTTACTGACGAA
GAAGTTGATGAAATGATTAGAGAAGCTGACTTGGATGGTGATGGTCATATCAACTATGAA
GAGTTCGTGAGAATGATGATGGCTAAATAA