Identifiers and Description

Gene Model Identifier

SteCoe_9543

Standard Name

None

Aliases

None

Description

CLPTM1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig18924.0.g314.590938473882946e-48Cleft lip and palate transmemb
rane protein 1 (CLPTM1)

WormBaseWBGene000113027.47197233734299e-43
Tetrahymena ThermophilaTTHERM_000160503.3057006267607343e-37Cleft lip and palate transmemb
rane protein 1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9543(Protein)
MEGQVAGQNQEVNQDRRGGFGFGSILQMILMYYVITSLTSSLFSSKDTKAKNVTPGYNNL
LADHDIIDFSLYLSEDSTEKLIWHESGITYDFEPSNNKEVLIKVDVTPSMLNNVTMLLLG
EFTLHSMAKKRIFKVKKTKELTKWMTKSNPDKVNLLSGEVSKDTSTEKFLHWIPSIDVQV
VHDTNFYKPFPPQIENKVTLEGFNYFPIIELSDFWVLKEHLVLVNDTISQLDLKLTFNIV
WIYKYMMYTQFEQSQTVGNTYGLHSEGEFDIMKKMFLETNPYFLSLTMFVSFIHMIFEFM
AFKSEIEFWKGRESLKGLSTNLLLYNFIASIIIFFYLLDSGETSWAVWLPMGIGIFIDFW
KITKGFDVKFSKKWPLVTIKGKESHKEGGTNQLDNAAVKYLAYILIPITIGYSIYGLYAY
QYKSWLSWFIGTLASIIYTCGFIMMTPQLYINYKLQSVAHMPWKVLTYRALNTFIDDMFA
FIIAMPTMHRLACLRDDVIFIIYIYQKWIYKVDPNRHYLDTEASEVKEEEKVVEDQKKNN


>SteCoe_9543(CDS)
ATGGAAGGTCAAGTCGCAGGTCAAAATCAAGAAGTTAATCAAGATCGTCGAGGGGGTTTC
GGTTTTGGATCCATACTTCAAATGATTCTCATGTACTACGTCATCACTTCTTTAACTTCA
TCTTTGTTCTCCAGTAAAGATACTAAAGCAAAAAATGTTACCCCAGGGTATAACAATCTT
CTGGCTGACCATGATATTATTGACTTTTCCCTTTATCTCTCAGAAGATAGCACTGAAAAA
CTTATTTGGCATGAATCAGGGATTACATACGACTTTGAACCTTCAAATAATAAAGAAGTT
CTTATCAAAGTTGACGTGACTCCCTCAATGCTCAACAATGTTACAATGCTTCTTTTAGGA
GAATTTACTTTACATTCAATGGCGAAGAAGAGGATTTTTAAGGTTAAAAAAACAAAGGAA
TTAACAAAGTGGATGACAAAGTCTAATCCTGATAAAGTGAATCTTTTGTCTGGGGAAGTT
TCGAAAGATACGTCGACAGAAAAATTTTTACATTGGATACCTAGTATTGATGTTCAAGTT
GTACATGATACTAATTTCTATAAACCTTTCCCTCCACAGATTGAGAATAAGGTTACATTA
GAAGGTTTTAATTATTTTCCAATCATAGAACTTTCAGACTTTTGGGTATTAAAAGAACAT
CTTGTATTGGTCAATGATACAATAAGCCAATTAGATTTGAAATTGACTTTTAATATTGTT
TGGATTTATAAGTATATGATGTATACTCAATTTGAACAAAGTCAAACTGTTGGAAATACA
TATGGTTTACATAGCGAAGGTGAATTCGATATTATGAAAAAAATGTTTTTAGAAACAAAT
CCTTACTTCCTCTCTCTTACCATGTTTGTCTCTTTCATCCATATGATTTTTGAGTTCATG
GCTTTCAAGTCAGAAATCGAATTCTGGAAAGGTAGAGAATCCTTAAAAGGTTTATCAACT
AACCTTCTCTTATACAACTTTATCGCAAGTATCATAATTTTCTTTTACCTTTTAGATAGT
GGAGAAACATCTTGGGCAGTATGGTTGCCTATGGGAATAGGTATATTTATAGACTTTTGG
AAAATAACAAAAGGTTTTGATGTAAAATTCTCTAAAAAATGGCCACTTGTGACTATTAAA
GGTAAAGAATCTCATAAAGAAGGAGGGACAAATCAGCTTGATAACGCTGCAGTAAAATAT
TTAGCTTATATTCTTATACCAATAACAATTGGTTATAGTATCTATGGACTTTATGCTTAT
CAATATAAAAGTTGGCTTTCTTGGTTTATAGGAACACTTGCTTCAATTATATACACATGT
GGGTTTATTATGATGACTCCACAACTTTATATCAATTATAAATTACAATCAGTTGCCCAT
ATGCCATGGAAAGTATTGACATATAGAGCACTTAATACTTTTATTGATGATATGTTTGCT
TTTATTATAGCTATGCCAACTATGCATAGACTTGCCTGTTTAAGAGATGATGTGATTTTT
ATTATTTATATATATCAGAAGTGGATATATAAAGTTGACCCTAATAGGCATTATTTAGAT
ACTGAAGCTAGTGAAGTTAAGGAGGAAGAGAAAGTAGTTGAAGATCAGAAAAAGAATAAT
TAA