Identifiers and Description

Gene Model Identifier

SteCoe_9780

Standard Name

None

Aliases

None

Description

RNase_PH domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Tetrahymena ThermophilaTTHERM_004631401.9287498479639178e-22exosome component RRP45
Oxytricha TrifallaxContig12411.0.g653.873997628687187e-213' exoribonuclease family, dom
ain 1

Saccharomyces CerevisiaeYDR280W1.1548224173015786e-17Exosome non-catalytic core com
ponent; involved in 3'-5' RNA
processing and degradation in
both the nucleus and the cytop
lasm; has similarity to E. col
i RNase PH and to human hRrp45
p (PM/SCL-75, EXOSC9); protein
abundance increases in respon
se to DNA replication stress
WormBaseWBGene000181543.1391327920480296e-17

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9780(Protein)
MEVLSNNEKGFILEAAGKGIRMDGRGLFDCRKLSINFTSTRGQVEVSLGDSLVLCSVDIF
IDSPYTDRPNEGFLTFNVEFLPMAHPNFEGLLGANLSQRHRRFKNELSAEIERVLEKSIK
KSRALNTESLCIVSGKHCWNVIVHMHILAHHGNLIDLCTQASVLALMHARVPDIKINPNK
TIELLPVLKPLSLHFLAISVTFGFLKGQIAILDPEIREEAILEGKIVICMNVYGDILALQ
KSGAAALKEDVIFQCLDLALVKTKETTKELRKAVEKAGEVDVDMENPEIRVNKLLAEIGG
VYIS


>SteCoe_9780(CDS)
ATGGAAGTCCTGAGCAATAATGAAAAAGGTTTTATCCTAGAAGCTGCAGGTAAAGGGATC
AGAATGGATGGCCGAGGACTTTTTGATTGTCGAAAACTTTCAATAAACTTCACTTCGACC
CGTGGTCAGGTTGAAGTGAGCCTTGGGGATAGTTTAGTCCTTTGCTCTGTGGATATTTTT
ATCGACTCTCCTTATACAGACCGGCCGAATGAAGGTTTTTTAACTTTTAACGTTGAGTTC
CTCCCAATGGCCCATCCAAACTTTGAAGGTCTTTTGGGTGCAAATTTGTCTCAGCGTCAC
AGAAGGTTTAAAAACGAGCTTTCGGCTGAAATAGAAAGGGTACTCGAAAAAAGCATTAAA
AAATCCCGAGCTTTAAACACTGAAAGTTTATGTATTGTCTCAGGAAAACATTGTTGGAAT
GTAATAGTCCATATGCATATCTTAGCCCATCATGGTAATCTTATTGATTTATGCACACAA
GCTTCAGTTTTAGCATTAATGCATGCAAGGGTTCCTGATATTAAAATCAACCCTAATAAA
ACTATTGAGCTTTTGCCTGTACTCAAACCTTTAAGCTTACATTTTCTTGCTATAAGTGTA
ACATTTGGATTTCTTAAAGGGCAAATCGCTATATTAGATCCTGAAATCAGAGAAGAAGCT
ATACTTGAAGGTAAAATAGTTATTTGTATGAATGTTTATGGAGATATTTTAGCTTTACAG
AAAAGTGGTGCTGCAGCTTTAAAAGAGGATGTAATTTTCCAATGTTTGGATTTAGCATTA
GTTAAGACAAAAGAAACTACAAAAGAACTAAGAAAAGCTGTAGAAAAAGCTGGAGAGGTA
GATGTTGATATGGAAAATCCTGAAATTAGAGTGAATAAGCTTTTGGCTGAAATTGGTGGG
GTTTATATAAGCTAG