Identifiers and Description

Gene Model Identifier

SteCoe_9969

Standard Name

None

Aliases

None

Description

Cnd1 domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
Oxytricha TrifallaxContig17170.0.g398.985825944049381e-37non-SMC mitotic condensation c
omplex subunit 1

Tetrahymena ThermophilaTTHERM_004860706.639677199580735e-36hypothetical protein
Saccharomyces CerevisiaeYLR272C7.781132241133797e-20Subunit of the condensin compl
ex; required for establishment
and maintenance of chromosome
condensation, chromosome segr
egation, chromatin binding of
condensin, tRNA gene clusterin
g at the nucleolus, and silenc
ing at the mating type locus;
required for replication slow
zone (RSZ) breakage following
Mec1p inactivation

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9969(Protein)
MEFVLPLKFEHLAEDRNESKFFVQSVFKVDNWDENKQKKQLEKVMNELFSTDESAFQIRK
FFDVFYAFIYHYQKLSNEMQDEVLKIVTAAFNSVVSYVEKNQTQDDDVLECFKMYLVLIY
GIFTRAKGISGSKAFKVLSRSLPQFKNLYSPEKPETRLLEIIIEIGFSEIERGSESEVVE
VMKWVKDIENPDIWDGWRAKAINVLFGESEKCVKPLVSIVKNDPSLLNDFLSSLSEGILA
NNQVNETQGIKNVGIFITKLTAKMPREILMNVSVIVHLLNCEVFSLRNAVVLSIGEILCY
IIKKDMDQSAERDTYTNYREQLLQILKSRIMDKSSFCRAKVLEAFETLTKESLLPRDWFL
PVLKLASSRLLDSTALVRKKATGLLENLVYQNKLLEGEMKIEPKESIEAQLQRHKDALKS
FENALEGQYDETTAGLDKEEAQQKSIKEQILVKFLEGYLEMIQIFQNSIKILIELLKSKN
TSDVIGSIDVLVACSLRDICEPNEVVSAMLSLVCNSEQGVRKKVLDAFYNIYLNKKFNNE
DSSINKILQMIEKLNIGQLASLESLFTELFAASMVPGEIKKKIWLKFKTEESYPSACILR
FLSLSTDRSFLERRYDTFASRTLALSKNWKIFRECLLAFQFLEYQGEKTDNLLCKAAHQL
FEIETSGWFPVAEQLIRTCSVLCESPLSVFKALAIKGLKILLEGNSREADLAKAIFIGGE
IAMKVVVYGDKLGSEFKKRMETTKTNDELEEINGGRAAQVQLELKALKMSQENIVFEGLL
SKFTPIILSLVKKLDEVKTLTLRKVLVLSLAKLMCINQKICEQNLLLLIKIAKENEDSGI
RSTAVISLGDLVMRHPNLLEQQSTQLFSLLTDACVEVRKKALLIISHLVLNDMLKMKGLM
ANILKCYLDLELRGIVCVFIEELNQKSPNDIYNMIPDSISNMLKMDLSHNEFKIIVDMIF
AYITKERQGENLTEKLSSRFKDGGKEDCLNIGYCLSKLPISEKAMRKLLDGISWWQNKVI
DDQQLLSYFADIATKCKRNWKSDSKVLIEEFEAAMRGEEEVVRKRKGRNNQ


>SteCoe_9969(CDS)
ATGGAGTTTGTCTTACCTTTGAAGTTTGAGCACCTGGCGGAAGACCGGAATGAAAGCAAG
TTTTTTGTTCAGAGTGTGTTTAAGGTTGATAATTGGGATGAAAACAAACAGAAAAAACAG
CTGGAGAAGGTTATGAATGAACTTTTTAGTACGGATGAAAGCGCTTTTCAGATCAGGAAA
TTTTTTGATGTATTTTATGCGTTTATTTATCATTATCAGAAGCTTAGTAATGAGATGCAG
GATGAAGTGTTGAAAATAGTTACGGCGGCATTTAATTCGGTGGTATCTTATGTCGAAAAA
AATCAGACTCAGGATGATGATGTATTGGAGTGTTTTAAGATGTACCTTGTACTTATTTAT
GGGATTTTTACTAGGGCCAAGGGAATTTCAGGGTCGAAAGCTTTTAAAGTCCTTAGTAGG
TCTTTGCCACAATTCAAAAATTTATACTCACCAGAAAAGCCGGAAACTCGTTTGTTAGAA
ATAATAATCGAGATAGGTTTTTCCGAGATCGAAAGAGGAAGCGAAAGCGAAGTAGTCGAA
GTAATGAAATGGGTCAAAGATATCGAAAACCCAGACATATGGGATGGATGGCGAGCCAAA
GCAATCAACGTGCTTTTCGGCGAAAGCGAGAAATGTGTCAAACCACTCGTAAGCATAGTA
AAAAACGATCCAAGTCTTCTAAACGATTTCTTATCCTCCTTATCCGAAGGTATTCTGGCA
AATAATCAAGTCAATGAAACCCAAGGTATAAAAAACGTCGGTATTTTCATCACAAAACTC
ACAGCAAAAATGCCAAGAGAAATACTCATGAACGTTTCAGTAATAGTCCACTTACTAAAC
TGTGAAGTATTTTCATTAAGAAATGCTGTTGTCTTATCAATAGGAGAAATACTTTGTTAT
ATCATCAAAAAAGATATGGACCAAAGTGCAGAAAGAGATACATATACAAATTATAGAGAA
CAATTACTTCAGATACTTAAAAGTAGGATTATGGATAAATCAAGTTTTTGCCGGGCAAAA
GTTTTAGAAGCTTTTGAAACTTTAACTAAAGAATCTTTATTACCTAGAGACTGGTTTTTA
CCTGTATTAAAATTAGCAAGTTCAAGGCTTTTAGATAGTACCGCGCTTGTGAGAAAAAAA
GCTACAGGGCTTTTAGAAAACCTTGTATATCAAAACAAGCTTTTAGAAGGGGAAATGAAA
ATCGAACCAAAAGAATCTATTGAAGCCCAGTTGCAAAGGCATAAAGATGCGCTAAAGTCT
TTTGAAAACGCTTTAGAAGGACAATATGATGAAACCACAGCAGGTCTTGATAAAGAAGAA
GCCCAACAAAAATCTATTAAAGAGCAAATCCTTGTAAAATTCCTTGAAGGGTATTTGGAA
ATGATACAAATCTTCCAAAACTCAATAAAAATCCTCATTGAACTTCTTAAAAGTAAAAAC
ACCTCAGATGTCATTGGGTCTATCGATGTTTTAGTTGCCTGTTCACTAAGAGATATATGT
GAACCTAATGAAGTAGTCTCAGCAATGCTCAGTTTAGTCTGTAATAGTGAACAAGGTGTT
CGTAAAAAAGTCCTCGATGCTTTCTATAACATCTACCTCAATAAAAAATTCAACAATGAA
GATTCAAGTATAAACAAAATCCTTCAAATGATTGAAAAATTAAACATAGGCCAACTTGCA
AGTCTTGAAAGCTTATTCACTGAACTTTTTGCAGCATCTATGGTCCCAGGTGAAATAAAA
AAGAAAATCTGGCTTAAATTCAAAACTGAAGAATCTTATCCATCAGCATGTATTTTAAGG
TTTTTATCTTTATCTACAGATAGAAGTTTTTTAGAACGAAGATATGATACTTTTGCTTCT
AGAACCTTAGCTTTATCTAAAAACTGGAAAATATTTAGAGAGTGTCTTTTAGCTTTTCAA
TTTTTAGAATATCAAGGAGAAAAAACAGATAATTTATTATGTAAAGCAGCACATCAGTTA
TTTGAAATTGAAACATCAGGATGGTTTCCTGTAGCAGAACAGCTTATTAGAACTTGTTCT
GTATTATGTGAAAGCCCATTATCTGTATTTAAAGCTTTAGCAATCAAAGGGTTAAAAATA
TTATTAGAAGGAAATAGTCGTGAAGCTGATTTGGCTAAAGCTATTTTTATAGGAGGGGAA
ATTGCTATGAAAGTTGTCGTATATGGGGATAAATTAGGCAGTGAATTTAAAAAACGTATG
GAAACAACAAAGACTAATGATGAATTAGAAGAAATCAATGGTGGAAGAGCTGCACAGGTG
CAATTGGAACTTAAAGCACTTAAGATGTCACAAGAAAATATTGTTTTTGAAGGTTTATTA
TCAAAATTCACCCCAATAATTTTGTCTCTTGTTAAAAAACTTGATGAAGTTAAAACTTTG
ACTTTAAGAAAAGTACTTGTATTGTCTTTAGCTAAGCTCATGTGTATTAATCAGAAAATC
TGTGAACAAAATTTATTACTTCTTATAAAAATTGCTAAAGAAAACGAAGATTCTGGGATA
AGAAGTACTGCGGTTATAAGCTTAGGAGATTTAGTTATGAGACACCCTAATTTACTTGAA
CAACAAAGTACACAGTTATTTTCTTTACTTACAGATGCATGTGTTGAAGTAAGAAAAAAA
GCCCTTTTGATTATAAGTCACTTAGTTTTGAATGATATGTTAAAAATGAAAGGGCTTATG
GCAAACATATTAAAATGCTATTTGGATTTAGAACTAAGGGGAATTGTTTGTGTTTTTATA
GAAGAGCTTAATCAAAAAAGCCCTAATGATATATATAATATGATCCCAGATTCAATAAGC
AATATGCTAAAAATGGATTTATCACATAATGAATTTAAGATTATTGTTGATATGATATTT
GCTTATATTACTAAAGAAAGACAAGGGGAAAATTTAACTGAAAAATTATCGTCGAGGTTT
AAAGATGGGGGTAAAGAAGATTGTTTGAATATTGGGTATTGTTTAAGCAAACTTCCGATT
AGTGAAAAAGCTATGAGGAAATTGTTGGATGGAATTTCTTGGTGGCAGAATAAAGTTATT
GATGATCAACAGCTTTTGAGTTATTTTGCTGATATTGCAACTAAGTGTAAGAGGAATTGG
AAGAGTGATTCAAAAGTACTTATTGAAGAGTTTGAAGCTGCGATGCGAGGAGAAGAAGAG
GTTGTTAGAAAGCGTAAAGGAAGAAATAACCAATAA