Identifiers and Description

Gene Model Identifier

SteCoe_9978

Standard Name

None

Aliases

None

Description

SET domain protein

Genome Browser

GBrowse

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

No expression data available at this time.

Homologs

SourceIdentifierScoreDescription
WormBaseWBGene000032200.00000000000009357622968840175
Oxytricha TrifallaxContig14971.0.g380.000000000013887943864964021LNS2 (Lipin/Ned1/Smp2)

Tetrahymena ThermophilaTTHERM_004996600.00000000003775134544279098Enhancer of zeste homolog, put
ative H3K27 HKMT
Saccharomyces CerevisiaeYJL168C0.0000022603294069810542Histone methyltransferase with
a role in transcriptional elo
ngation; methylates H3 lysine
36 (H3K36), which suppresses i
ncorporation of acetylated his
tones and signals for the deac
etylation of these histones wi
thin transcribed genes; associ
ates with the C-terminal domai
n(CTD) of Rpo21p; H3K36me3 (tr
imethylation) requires Spt6p,
proline 38 on H3, CTD of Rpo21
p, Ctk1p, and C-terminal SRI d
omain of Ste2p; relocalizes to
the cytosol in response to hy
poxia

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>SteCoe_9978(Protein)
MDPELIQILRTILEKYKKFKDTERYYLIYLNTPTKNDLQLPEYKISQIPQVNYEIEIPES
VVKPFTTNFVRTPINIAAKEKENLDFLPYDEINNKVYYSPDLEVFKTTPFNQHVHRSEFV
LNTQFYEYMILSLIKSYPLTQDWIHVSNTIADDLNKSRRLMMSIFTSVINKYFNNTENEL
KKQEFKDNFCQMCMRYACATHFYDDKVEYDSDNQDIEENNIREQYKDDTILTIDPDNWKT
IWWSNQKNVLKTGRWFNGYKCFDPILCFKTTININKPIKPIQKQIIKKLLKMGLSNPCAI
SLFIELECKSTAPYIQKYTEKYVPPTPPIPLPKKVFYTSIFDYKNYIINVIETHCKCKGE
CTIKGKCPCLIGETVNGKVVARRCCEKYCICSTDCKQRFLGCSCKYGRCDSRTCVCKANL
RECDPELCIFCHSAFTLAKKPIKAITTKKKERFLCRNMKNQLRFIKKTAISESGIRNAGM
GLYVLENCDKGDYITEYTGELIREAESERRAATYDYKHHSYIFSLSPDIRWSIDSTNFGS
KMRYVNHRSHQEQNTYAQVWSIEGQLKILLFAQEKISSGQELFFDYGYDSKEIKYEWLQE
YERRFKNKKPKI


>SteCoe_9978(CDS)
ATGGACCCCGAACTAATCCAAATTCTTAGGACTATATTAGAAAAGTATAAAAAGTTCAAA
GATACTGAAAGATATTATCTTATATATTTGAATACACCAACAAAAAATGATTTACAATTA
CCTGAGTATAAGATAAGCCAAATCCCACAAGTGAATTATGAAATTGAAATACCTGAAAGT
GTGGTTAAGCCTTTTACAACAAATTTTGTTAGAACACCTATTAACATTGCTGCAAAAGAA
AAAGAGAATTTGGATTTTTTACCTTATGATGAGATAAATAATAAAGTTTATTACTCGCCT
GATTTGGAGGTTTTTAAAACTACACCTTTTAATCAACATGTGCATAGGTCGGAGTTTGTA
TTGAATACTCAATTTTATGAGTATATGATTCTAAGTCTTATCAAATCATACCCATTAACT
CAAGATTGGATTCATGTATCTAATACAATTGCTGATGATTTAAACAAATCACGAAGGCTT
ATGATGTCTATATTTACATCTGTAATAAACAAATACTTTAATAATACAGAAAATGAGTTG
AAAAAACAAGAATTTAAAGATAATTTCTGTCAAATGTGCATGAGATATGCTTGTGCAACA
CATTTTTACGATGATAAAGTTGAATATGATTCAGATAATCAAGATATTGAAGAAAATAAT
ATAAGAGAACAATATAAAGATGATACTATTTTGACTATTGATCCTGATAATTGGAAGACA
ATATGGTGGAGTAATCAAAAAAATGTCCTTAAAACAGGAAGGTGGTTTAATGGATATAAA
TGTTTTGATCCAATATTATGTTTTAAGACTACTATTAATATTAATAAACCTATAAAACCA
ATACAGAAACAAATAATCAAAAAGTTGCTAAAAATGGGGTTGAGTAACCCTTGCGCAATA
TCTTTGTTTATTGAGTTAGAATGCAAATCCACAGCTCCATATATACAAAAATACACTGAA
AAATACGTCCCACCTACCCCCCCAATACCTTTACCAAAAAAAGTGTTTTATACAAGTATT
TTTGATTATAAAAACTATATAATTAATGTTATTGAAACTCATTGTAAATGCAAAGGAGAA
TGCACAATTAAAGGCAAATGCCCTTGTCTAATAGGAGAAACAGTAAATGGTAAAGTTGTA
GCAAGACGTTGTTGTGAAAAATACTGTATTTGTTCAACAGATTGTAAACAACGTTTTCTT
GGATGCAGCTGCAAATATGGTAGATGTGATAGTAGAACCTGTGTCTGTAAAGCTAATCTA
CGAGAATGTGACCCAGAGCTCTGTATTTTCTGCCACAGTGCTTTTACATTAGCAAAAAAG
CCAATCAAAGCTATAACAACAAAGAAAAAAGAAAGATTTCTTTGTAGAAACATGAAAAAT
CAACTTAGATTCATAAAGAAAACAGCAATCAGCGAATCTGGGATTAGAAATGCTGGAATG
GGTCTTTATGTCTTAGAAAACTGTGATAAAGGAGATTATATAACTGAATATACTGGAGAA
CTTATAAGAGAAGCTGAAAGCGAAAGAAGAGCAGCAACATATGATTATAAACATCATTCT
TATATTTTCAGTCTTAGTCCTGATATAAGATGGTCAATTGATTCTACTAATTTTGGTAGT
AAAATGAGATATGTTAATCATAGAAGTCATCAAGAACAAAATACTTATGCACAAGTGTGG
AGTATTGAAGGACAGCTTAAAATATTGTTGTTTGCGCAAGAGAAGATTAGTTCGGGACAG
GAGTTGTTTTTTGATTATGGATATGATAGTAAAGAAATCAAGTATGAATGGCTACAGGAA
TATGAAAGGAGGTTTAAGAATAAAAAACCGAAAATTTAG